SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522109|ref|NP_925486.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522109|ref|NP_925486.1|
Domain Number 1 Region: 19-216,317-404
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.2e-83
Family Bacterial dinuclear zinc exopeptidases 0.0000186
Further Details:      
 
Domain Number 2 Region: 203-310
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 6.8e-30
Family Bacterial exopeptidase dimerisation domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522109|ref|NP_925486.1|
Sequence length 406
Comment hydrolase [Gloeobacter violaceus PCC 7421]
Sequence
MYLSPSNEFSAARPALLQAISAETHRVLPRLVALRQHLHAHPELSGEEYRTADCVAELLA
ELGLEVKSGVGRTGVVGLLTGNGRDERTVGVRADMDGLPIAEQTELPYRSQVRGVMHACG
HDLHTAIGLGTAMVLASLRESLPGRVKFLFQPAEETAQGARWMVDDGALEDPRVSALFAL
HCFPSLPVGVIGVRPGVFTAAADSLVIEVFGRSGHGARPHEAVDAIWVAANVVTALQQGI
SRMHNPLRPVVLSIGQMQGGRAPNIICDHVVLKGTVRSLDPQTRTALPTWIEQIVAQTCA
AFGADYRLHYGNGTPSVINDPHLTHLVEDCVRTLLGAQYLQALPEPSMGAEDFAVFCEQV
PGTMFRLGVGGPTSYPLHHPSFDGGDGAIAPGVMTLAAAAVSYWRL
Download sequence
Identical sequences Q7NHJ5
NP_925486.1.44878 gi|37522109|ref|NP_925486.1| 251221.glr2540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]