SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522175|ref|NP_925552.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522175|ref|NP_925552.1|
Domain Number 1 Region: 101-159
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000288
Family Carboxypeptidase regulatory domain 0.032
Further Details:      
 
Domain Number 2 Region: 25-85
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000693
Family Type I dockerin domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522175|ref|NP_925552.1|
Sequence length 361
Comment hypothetical protein gll2606 [Gloeobacter violaceus PCC 7421]
Sequence
MAVAVYALLSAIAAVLVVLAVPAVAQSGDANGDGRFDGKDIETIDAYLAGTALLQDEQIR
AADGDGDGRITGADREKLAGRLMGMTRGQGPGEIQAESADSGVVVDRATGKPLAGVEVSL
PDEGVSVRTDSEGRFKLPKSSAGKILTAKADNYAPSAAAGGKRRGFRLELERLSPRLVVL
DDRVHHLGDDKYGYGSANYSEFRLQAQGPRLERAFEIDGEPEDLTLRIGSLIGLDTAHSV
AAGQSALSQFAGSRPDGLRIYLNDRPLQKIYLNGDNIAVRLPAALLRRGENRLRLETHPL
RLPGAAGDELEDLRRRFGLVNYDDVELAHLLLVDSSASARRIRVRGDVVRTPRAGNDGTN
P
Download sequence
Identical sequences Q7NHD1
251221.gll2606 gi|37522175|ref|NP_925552.1| NP_925552.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]