SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522180|ref|NP_925557.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522180|ref|NP_925557.1|
Domain Number 1 Region: 187-502
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.79e-116
Family Leucine aminopeptidase, C-terminal domain 0.000000303
Further Details:      
 
Domain Number 2 Region: 1-190
Classification Level Classification E-value
Superfamily Macro domain-like 2.3e-31
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522180|ref|NP_925557.1|
Sequence length 504
Comment leucyl aminopeptidase [Gloeobacter violaceus PCC 7421]
Sequence
MEFEAVRISPGKYRGDALLVGLFQDGPEPALALAALDAAVAAVVLEVISEEEFKPKSRQK
LTVRVGGDTGLRKVVLVGLGEQAKYKPESLRQCIGEGARTLKAIKATTAGVWVPPLGEGG
EEATVEALVEAIRLALHEDRRFRSKKSDSEENGNSNNGGENKLTKVSLVVAGEGDYAAAV
RRGNILAEGTIFARELVSAPANYVTSVTLAEQATAIAEANGLECEILEKEDCERLGMGAY
LGVAQGTDLPPKFIHLTYKPAHSAPRKRIAIIGKGITFDSGGLSIKPAKGMELMKVDMGG
AAAALGAAKVLGQLKPDIEVHFIVAATENMVSGHAIHPGDILTASNGKTIEVDNTDAEGR
LTLADALVFSEKLGVDAIVDLATLTGACVVALGNDIAGLLTENEELARQIRAAGEASGEK
FWQLPMEESYFEGMKSVVADMRNTGSREGGTITAALFLKQFVEKTPWVHLDIAGPVWTEK
QKGYTNRGGTGFGVRTLVRFVLAQ
Download sequence
Identical sequences Q7NHC6
251221.glr2611 gi|37522180|ref|NP_925557.1| NP_925557.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]