SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522227|ref|NP_925604.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522227|ref|NP_925604.1|
Domain Number 1 Region: 69-111,238-410
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.05e-47
Family Bacterial dinuclear zinc exopeptidases 0.0028
Further Details:      
 
Domain Number 2 Region: 126-231
Classification Level Classification E-value
Superfamily PA domain 5.36e-16
Family PA domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522227|ref|NP_925604.1|
Sequence length 444
Comment aminopeptidase [Gloeobacter violaceus PCC 7421]
Sequence
MRALVINWMLPSKTVDNSLPQPSGTREPTARLESISLRWLSMVQPWRAGGAVLLAISLLV
FAQPVYPLAERLGADVQALLAGGPRVAGSAAAERASAYLGEQYRAAGYEVEIQPFSFEKF
NDLGSSLLVEDERLKGRALSGSIAGNAATAAVVVPGVGESADFARVDVKGAVAIVRRGKI
PFLEKARQAAQAGAVGLVVVNSQDGPLMGTLGGKAAIPVLGLSGKQGSALLAGKFPKPVQ
LEVRTEVVSLTGRNVIARLAGVSTPQVLLGAHYDSVEGAPGANDNASGSAVLLESARRLA
GTPLARRAWFVHFDAEEEGLVGSRHFVRSASAPLIKALRGMLNFDMVGVNEKLLVGGTPE
LVALVEKSVSAVQKVRPSNASDHASFAAAKVPVLFFHRGQDPNYHQPGDKQVDPRLLEAT
VEAALGTVGALLPPALSESPERSL
Download sequence
Identical sequences Q7NH79
NP_925604.1.44878 gi|37522227|ref|NP_925604.1| 251221.glr2658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]