SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522317|ref|NP_925694.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522317|ref|NP_925694.1|
Domain Number 1 Region: 55-227
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.22e-72
Family HD domain 0.00000224
Further Details:      
 
Domain Number 2 Region: 229-402
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.43e-62
Family RelA/SpoT domain 0.00000589
Further Details:      
 
Domain Number 3 Region: 412-484
Classification Level Classification E-value
Superfamily TGS-like 2.62e-24
Family G domain-linked domain 0.038
Further Details:      
 
Domain Number 4 Region: 675-755
Classification Level Classification E-value
Superfamily ACT-like 5.41e-16
Family Glycine cleavage system transcriptional repressor 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522317|ref|NP_925694.1|
Sequence length 758
Comment (p)ppGpp 3'-pyrophosphohydrolase [Gloeobacter violaceus PCC 7421]
Sequence
MRKGVVGGMHLVSAEFETLQLPDWLKDCLDHPHGTQEWTTANSETSLTTPRTVSLDRGLI
ARAFDFAYRLHTGQNRASGEPYILHPVQVAGMLRELGSDSAMVAAGFLHDIIEDTATTSE
DLEQLFGEQVRLLVEGVTKLSKFTFDSKEERQAENFRRMFLAMAQDIRVIVVKLADRLHN
MRTLDFLPTHKQRRIAQETMDIFAPLANRLGIWRFKWELEDLAFKYLDPDAYRHMQKLVS
QKRAEREQFIDQVVQTIRAEIDRQHIHGEITGRPKHLWGIYQKMQRQQKEFHEIYDVSAV
RIIVEQQEECYRALSIVHNKFRPIPGRFKDYIGLPKPNRYQSLHTAVVGPEGKPLEVQIR
TVDMHRIAEYGIAAHWKYKEAGSVVVASQEEKFTWLRQLLDWQSDLKDAGEYLETIKEDL
FYSEVYVFTPKGDVVELPRGGTPVDFAYRIHTEVGNRCVGAKVNDRMVPLDSQLKNGDIV
EILTSKNSHPSLDWINFVVTSSAKNRIRQWFKRSTREQNIEQGRDMLARELGKGNLENLL
KSDRMLKVAQRLNFTTVEDLLAALGYGEVTQASVLNKLQESTPTSTPAEMVELPTQKSAG
MPTPSDKPILGIEGIPYHLAKCCNPLPGEPIIGVVTRINRSISIHHHGCPNATKVDPDQL
IPVSWNRSYTQPGRPHTYPVEIQVEVIDRIGMLKDLLDRLASERINVRDARVSTYPNSTA
IVDLKIDITGKQQLDQVAAQMGKMADVLTVRCRHRHRE
Download sequence
Identical sequences Q7NGY9
251221.glr2748 gi|37522317|ref|NP_925694.1| NP_925694.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]