SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522413|ref|NP_925790.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522413|ref|NP_925790.1|
Domain Number 1 Region: 13-329
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.68e-106
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522413|ref|NP_925790.1|
Sequence length 331
Comment pyruvate dehydrogenase E1 alpha-subunit [Gloeobacter violaceus PCC 7421]
Sequence
MNTVAQVLRPAVERSEALALYRDMVLGRTFEDTCAQMYYRGKLFGFVHLYNGQEAVSTGI
IKALRPDDYVTSTYRDHVHALSKGVSARSVMAELFGKATGCSKGRGGSMHLFSAEHNFLG
GFAFIGEGIPIACGAAFTAKYQGTDRVSASFFGDGTTNNGQFFECLNMAALWKLPILFVV
ENNLWSIGMYHPRASSVVEIYKKADAFGIPGVRVDGMDVLAVRAVAKEAVERARTGGGPT
LIECTTYRFRGHSLADPDELRDPAEKAHWRKQDPLPRLRVWLEEQGLASVEDLKRIEQEV
RAEVDDAVQFAEDSPEPPLDELYRFQFAEDD
Download sequence
Identical sequences Q7NCY2
gi|37522413|ref|NP_925790.1| NP_925790.1.44878 251221.glr2844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]