SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522495|ref|NP_925872.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522495|ref|NP_925872.1|
Domain Number 1 Region: 204-390
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.99e-63
Family B3/B4 domain of PheRS, PheT 0.00000475
Further Details:      
 
Domain Number 2 Region: 467-678
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-41
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00013
Further Details:      
 
Domain Number 3 Region: 36-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-40
Family Myf domain 0.0019
Further Details:      
 
Domain Number 4 Region: 687-784
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.41e-25
Family Anticodon-binding domain of PheRS 0.00062
Further Details:      
 
Domain Number 5 Region: 402-474
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000011
Family Domains B1 and B5 of PheRS-beta, PheT 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522495|ref|NP_925872.1|
Sequence length 785
Comment phenylalanyl-tRNA synthetase subunit beta [Gloeobacter violaceus PCC 7421]
Sequence
MRVSFNWLQEYVEFDFTPSELAEKLTMAGFEVEHVEDRRTWAAGVVVGRVLECAPHPQAD
RLHVCRVDIGTGRLLNIVCGAPNARAGIYAPVAPVGTYLPIKDLKLRAASIRGMPSEGML
CSLEELGLEKASEGIHIFPEASLPLGLDVGPLLGLDDAILEVASTANRADALSMVGIARE
VAALTGGILRLPLVDAPLVPRGDLAARIAEPEACPVYTATLLEEVAVGPAPDWLRERLEK
AGMRPINNVVDVTNYVLLEWGQPLHAFDADRLAAGTLGVRFAHKGEQLVTLDGTERPLTP
ANLLITAGERPVALAGVMGGEATEVGGQTRRIVLEAAIFDPPAIRRSARVFALRTEASAR
YERGVDASALEHALGRALQLLADCAGARAVVQATDDYRRRENRVVSLRPERLAQILGEDI
PDAEIARVLKNLGFDVQTGPQEFAVTVPGHRLRDIEREIDLIEEVARVVGYDRFAPTLPP
PADGGYLPFEDFIERRVRSLCQGAGLTEVVTYSLAPDRDQQPVVLSNPLSAELNSLRTNL
IDGLLEILRFNRSQGNMPFHAFEVGVVFLRSDEGIFESGRLGAVMCGEPAVGDWQKLTPP
FDWFAAKGVLAAILQPWQIEVEYQADRRDERLHPGRTASLWVSGERLGTLGQLHPRLASR
LDLPEQTFVFEIDLDFLIDLVRERPVEFRSFSPFPPAARDLSFYAREALTVFEFERLIRE
QGEPLLESVALLDEFKGQGVPEGCRSLAFRMVYRSDHTLTEEEITAVHQRVRQALAERYS
VDLRS
Download sequence
Identical sequences Q7NCQ2
gi|37522495|ref|NP_925872.1| NP_925872.1.44878 251221.gvip406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]