SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522598|ref|NP_925975.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522598|ref|NP_925975.1|
Domain Number 1 Region: 5-374
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.13e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0013
Further Details:      
 
Domain Number 2 Region: 339-451
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.59e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522598|ref|NP_925975.1|
Sequence length 459
Comment dihydrolipoamide dehydrogenase [Gloeobacter violaceus PCC 7421]
Sequence
MAFDYDLLIIGCGVGGHGAALHAVAHKLKVAVVEARDLGGTCINRGCIPSKALLAAAGRL
RVLRESEHLGISVGEISFDRAKIAHHAASVVDKIRADLTKSLQKLGVTILHGHARLKGSQ
TVEIDPGEGGGEVQVLTARDVLIASGSQPFVPPGIVTDGKTVYTSDEGVRLEHLPEHICI
IGSGYIGLEFSDVYTALGTKVTMIEALDRLMPGFDPDIARLAARLLVKSRDIDTKVGVFA
KKVTPGQPATVELSTGEQLQFDAVLVACGRTPDTKNLGLESVGLETARGFIPVDGRMATS
AEHLWAIGDATGKMMLAHAASAQGIVAVDNMLGHERTIDYRSIPAACFTHPEIGFVGLTE
PQAKEQGYKVGVVRTYFGGNSKAIAQGDTEGMAKIVYDQTTGELLGCHIIGPEASLLVAE
AAQAIAGRDRIERLAHLVHTHPTLSEILDEGYKRAAAVL
Download sequence
Identical sequences Q7NCF0
gi|37522598|ref|NP_925975.1| 251221.glr3029 NP_925975.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]