SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522619|ref|NP_925996.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522619|ref|NP_925996.1|
Domain Number 1 Region: 7-164
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.79e-22
Family Precorrin-6Y methyltransferase (CbiT) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522619|ref|NP_925996.1|
Sequence length 193
Comment methyltransferase [Gloeobacter violaceus PCC 7421]
Sequence
MQPERPSLMPEYFEALYCENADPWDFETSPYEDAKYTATLDALSKPRYRSAFEIGCSIGV
LTARLAERCEALLAVDVCDKALTRARARCRTLAQVSFERLRVPECYPSGPFDLTLVSEVG
YYWSWSELRRAQRLLLEHLEPGGQLLLVHWTPFARDYPLRGDEVHDAFDSLAGLSHRLGR
REEQYRLDLYERI
Download sequence
Identical sequences Q7NCC9
NP_925996.1.44878 gi|37522619|ref|NP_925996.1| 251221.glr3050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]