SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522642|ref|NP_926019.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522642|ref|NP_926019.1|
Domain Number 1 Region: 374-580
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.12e-28
Family TK-like Pyr module 0.027
Further Details:      
 
Domain Number 2 Region: 45-338
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.2e-28
Family TK-like PP module 0.0057
Further Details:      
 
Domain Number 3 Region: 586-737
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000349
Family Transketolase C-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522642|ref|NP_926019.1|
Sequence length 738
Comment hypothetical protein glr3073 [Gloeobacter violaceus PCC 7421]
Sequence
MVVTPQQLSTLPAFCEGIQYFAEPGDLFAIHSKQPVITQGQDAVADPADPEAVFQTLLAA
DALRYLTLQITASKASGHPGGFASSAEAVAALFMLGHKNMPTEVGHHAPGYYSAMFLDRS
LEAMGIETVAQLRERYRERHGLLGHLSGFIPGILSPAGPLGQGQHFAMAGAKLYPGTLFP
VTIGDGGLGEPYVLSAFGHFHTAFPEITNFLPVLVWNGFSQEHHSMVSTVGNEAMINLWR
AQGFEEVFLVDAKSFDDQDQQGGPYVDSTRFGFTQRLAFTAAVLAAAHRAAQAALGGKLC
VLIIKQLKGAGVHAHGAKSHNLYAQHTLDNPDIVSALQSRALPPEAWALVRANFERAGGG
PAARVAVTESVRPLPQLGELPCEAFEVGGPAKVATTAMGNLVAAVGRADRSFIVSNADGN
EASGIANINQALRIVHPTADALYYQEPGGQVYEPLSEDACAGLAAALSLLGCRSLWCSYE
SFAINGLPIWQTVTQAMAELRRPTPSTVCLFTAGALEQGRNGWTHQRPEIENYFAALMRN
GNVYPVFPVDANSIQATYTWALGTVNKGIAIFASKTPLPVRITLDQGRQALAEGAITLLQ
SSETPRVTFAVVGDMALLPVFEAAQSLAALGIAGRIVSVVNPRRLYRPSDVAWQSCSEAD
GEFLSDEGFERLFGTEVLVGVTGGAGGMLEPVFLRSQARRRETFCWKRGETTASPGELMA
FNGLTAASLCERVQQLLL
Download sequence
Identical sequences Q7NCA6
gi|37522642|ref|NP_926019.1| NP_926019.1.44878 251221.glr3073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]