SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522848|ref|NP_926225.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522848|ref|NP_926225.1|
Domain Number 1 Region: 363-563
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.79e-65
Family Pyruvate oxidase and decarboxylase PP module 0.0000114
Further Details:      
 
Domain Number 2 Region: 190-359
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.58e-65
Family Pyruvate oxidase and decarboxylase, middle domain 0.000017
Further Details:      
 
Domain Number 3 Region: 3-181
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.94e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522848|ref|NP_926225.1|
Sequence length 596
Comment acetolactate synthase 3 catalytic subunit [Gloeobacter violaceus PCC 7421]
Sequence
MQATGAFAVVDSLCCQGVRHIFGYPGGAILPVYDEIYKAEAEGRFQHFLVRHEQGAAHAA
DGYARATGRVGVCVATSGPGATNLVTGIATAHMDSVPMVAITGQVPRRSIGSDAFQEADI
LGITLPIVKHSYVIRNTGDIGRIFSEAFHIASSGRPGPVLIDVPKDVGQESFEYTPVQTT
PKIPGYRPTTRGNPRQVAAAAKLILEADRPLLYVGGGAISAGAHAELMRLAELGLIPTTT
TLMGKGAFPEDHPLAVGMLGMHGTAYANFAVTECDLLIAVGARFDDRVTGKLDEFAARAR
VIHIDIDPAEVGKNRGPEVPIVGDVKLVLQDLIKKLIEFQPRTRAWLERIERWKAEYPLE
VPSDGTRLYPQEVMVAFRELATDAYYTTDVGQHQMWAAQFLKNGPRRWISSGGLGTMGYG
FPAAIGVQVALPDEDVVCISGDASFQMNLQEIGTAVQYDLPVKAAIVNNGWQGMVRQWQE
FFYDRRFSHSHMKPSMPDFVKLAEAFGAEGMVIDHPDQLKEGIEALMERDRPVICDFHVV
PDANCYPMVPPGKANHQMVGLPRPLPMQPLELIYCPNCGTKNTTANRFCPECGTKL
Download sequence
Identical sequences Q7NG94
NP_926225.1.44878 251221.gvip452 gi|37522848|ref|NP_926225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]