SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522856|ref|NP_926233.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522856|ref|NP_926233.1|
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.68e-17
Family 7-Fe ferredoxin 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522856|ref|NP_926233.1|
Sequence length 81
Comment photosystem I subunit VII [Gloeobacter violaceus PCC 7421]
Sequence
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGNKAGTIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences Q7NG86
gi|37522856|ref|NP_926233.1| 251221.gvip455 NP_926233.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]