SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522976|ref|NP_926353.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522976|ref|NP_926353.1|
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.62e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.00017
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 5.89e-28
Family Middle domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 3 Region: 226-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522976|ref|NP_926353.1|
Sequence length 284
Comment formamidopyrimidine-DNA glycosylase [Gloeobacter violaceus PCC 7421]
Sequence
MPELPEVETLRRDLLIHLPGERVVGVEVLRSDSVGYPADPAIFIEQMQGQIFSDRMLRRG
KYLLLYFARGAALGVHLRMSGRLLWRCGEAPLEPHTRVRIPMASGHELRFEDMRVFGRLW
LIPVGVPPERVMGGLTRLGPEPFAEMFDGPYLAGRFAGRNQPVKSALLDQQLVAGVGNIY
ADEALFSSGIHPALPVGGLDAAALERLHRAVVKVLEAGIAQRGATLRNYTDAQGINGNYA
GTAWVYGRKGQPCRVCNTPIERIRLAGRSTHFCPTCQRAQQSVQ
Download sequence
Identical sequences Q7NFW7
NP_926353.1.44878 251221.gvip464 gi|37522976|ref|NP_926353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]