SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523184|ref|NP_926561.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523184|ref|NP_926561.1|
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000235
Family Intein (protein splicing domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37523184|ref|NP_926561.1|
Sequence length 80
Comment hypothetical protein gsl3615 [Gloeobacter violaceus PCC 7421]
Sequence
MPGEHPFFLQNKGWTAAERLEPGDRVQAAEGKRLRVAGLAAQEQTRKTYNLEVEGDPAPS
ASLATPRLGYTTCVQLFLGL
Download sequence
Identical sequences Q7NFB1
gi|37523184|ref|NP_926561.1| 251221.gsl3615 NP_926561.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]