SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523652|ref|NP_927029.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523652|ref|NP_927029.1|
Domain Number 1 Region: 119-429
Classification Level Classification E-value
Superfamily DNA primase core 2.62e-93
Family DNA primase DnaG catalytic core 0.00000774
Further Details:      
 
Domain Number 2 Region: 6-102
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.72e-32
Family DNA primase zinc finger 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523652|ref|NP_927029.1|
Sequence length 638
Comment DNA primase [Gloeobacter violaceus PCC 7421]
Sequence
MSAPQLHPRTIDEVRAKADLVDVVSERVVLRKAGRDFKGLCPFHEDRSPSFYVSPGKQIY
KCFACGASGDVFKFVMELDKSAFGEVVLELARRFGVPVQTLKPEQKAEYTRKLSKQQQLG
EILELAAQFYSYALWGERGAAARQYLLEARALSEKTIRQFRLGFAPEGWQSLYTYLVDQK
RFPASLVEEAGLIIPRSSGQGYYDRFRHRLIIPICDLKGKVIAFGGRAMGDEQPKYLNSP
ETELFNKGQTLYALDQARESVGRTDGAIVVEGYFDAIALHQSGISHVVATLGTSLRTDQI
KQLLRYTESKRVVLNFDADAAGVQAAERAIAELRPLVVKSGVQLRIVALPAGKDPDEFLR
SHPPQEYLKLASEAPLWIDWQIERLFAGRDLSLAADFQQVSQGLVELLSGLLSSMTRAHY
IHLIAGQLSQGNGRLASQLEDELRRRIRTHRWGGGDGKSKKKREPFPPACFQAEVQLIQI
YLHFAEYREDIHRGLDEHDLEFSVLHHRQLWQKILQLREEIGEDDDVVVALRTMYAGDPE
LNQRLGQLLWLNEHNRIALMRPRMVIRAGLATLQLDRCERRYNYLNQLCDEAERRGAWEE
ADYFVEQRNAEYHRINDLKTHLTLKLGEISETAVWQES
Download sequence
Identical sequences Q7NDZ9
251221.gvip547 NP_927029.1.44878 gi|37523652|ref|NP_927029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]