SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523660|ref|NP_927037.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523660|ref|NP_927037.1|
Domain Number 1 Region: 9-187
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 4.93e-38
Family Hypothetical protein TT1808 (TTHA1514) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523660|ref|NP_927037.1|
Sequence length 188
Comment hypothetical protein gll4091 [Gloeobacter violaceus PCC 7421]
Sequence
MQQAAGERVRWTAADLELLPDNGNRYEIVEGELLVTRAPHWKHQQVCLRIGAALDVWSNR
TGLGQAAVAPGILFSEADNVIPDVVWASTSRLEALLDEAGHLVGPPELVVEVLSPGADNE
RRDRELKLKLYSLRGVQEYWLVDRRVGCVEVYRREKAMLKLAGTFLVGDTLTSPLLANFA
CPVGPLFA
Download sequence
Identical sequences Q7NDZ1
NP_927037.1.44878 gi|37523660|ref|NP_927037.1| 251221.gll4091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]