SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523718|ref|NP_927095.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523718|ref|NP_927095.1|
Domain Number 1 Region: 6-120
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.32e-27
Family Single-domain sulfurtransferase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523718|ref|NP_927095.1|
Sequence length 123
Comment hypothetical protein gll4149 [Gloeobacter violaceus PCC 7421]
Sequence
MDPFACVFLPMPYQEISVAELQRKLASQAEGTQFVDVREPEELEQSRLDGFINLPLSHYQ
EWSMRLGEILDPQKETIVLCHHGMRSADMCSFLLRRGYENVKNVQGGIHAYSLYVDPNVP
RYM
Download sequence
Identical sequences Q7NDT3
gi|37523718|ref|NP_927095.1| NP_927095.1.44878 251221.gll4149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]