SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523722|ref|NP_927099.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523722|ref|NP_927099.1|
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily RING/U-box 3.41e-29
Family Zf-UBP 0.0000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523722|ref|NP_927099.1|
Sequence length 84
Comment hypothetical protein gsr4153 [Gloeobacter violaceus PCC 7421]
Sequence
MAKCKHTDQIRTVTPSANGCEECLAMGERWVHLRECLSCGHIGCCDSSKNKHATRHFVDT
GHPIVRSFEPGEDWRWCYIDRSFV
Download sequence
Identical sequences Q7NDS9
NP_927099.1.44878 251221.gsr4153 gi|37523722|ref|NP_927099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]