SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523765|ref|NP_927142.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523765|ref|NP_927142.1|
Domain Number 1 Region: 75-417
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.65e-73
Family Extended AAA-ATPase domain 0.00000000903
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000105
Family ClpX chaperone zinc binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523765|ref|NP_927142.1|
Sequence length 437
Comment ATP-dependent protease ATP-binding subunit ClpX [Gloeobacter violaceus PCC 7421]
Sequence
MPKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVELCNEILDEELFEGATQPQPQPTK
VKASRSSRRDTSLKKIPKPQEIKSYLDQHVIGQQEAKKILSVAVYNHYKRLSSKLEESGD
EVEIQKSNILLIGPTGCGKTLLAQTLADLLDVPFAIADATTLTEAGYVGEDVENILLRLL
QVADGEVERAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQG
GRKHPYQEYIQIDTANILFVCGGAFVGLERVVEQRIGKRAMGFVQAGEPQKREQRLVESL
KALEPDDLVKFGLIPEFIGRIPMVAVLEPLDEEALIEILTEPKNALLKQYQRLLRMDGVE
MVFEPDAIKTIAQEAFRRKTGARALRGIVEELMLEVMYEVPSRADIRKCVITREMVEKRS
TSELLILPSSLPKPESA
Download sequence
Identical sequences Q7NDN9
NP_927142.1.44878 251221.gvip552 gi|37523765|ref|NP_927142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]