SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523811|ref|NP_927188.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523811|ref|NP_927188.1|
Domain Number 1 Region: 2-351
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000055
Family iota-carrageenase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523811|ref|NP_927188.1|
Sequence length 478
Comment hypothetical protein gll4242 [Gloeobacter violaceus PCC 7421]
Sequence
MGDGKFDNWQVLQKALADGWTNLCIPGGYWRITRPLVVPASLTRGSTVRIAGPSNAYSII
LCDLPDTYADRGALEYFANAEGFSWGIVLEHLQLQGSHRGGPARCHGIHLKQIAYALCTD
VAVNRFDGAGLLIDKCQDGEFRNLNIQDCGRSAGDPADPAQTLYSALHLTNSAVPGDACN
MLRFNALQCENNRVSPYISVRLGVGNGPIGIFFSQVHGEVREAKQQGQFEFLRAEGGDFQ
FEGMALVGFKTGFVFTGYGVATFANSRSLCGIRHPTPNIVAGSLISNCAGVGNLYSNAVR
PGFKVVNSVVGDVRLDYPGAANQRFSHCDLGRVAVNQQGGTGLGVYITSCTLASLAIDAA
THGHYAFNVITGDLSCRGQNGDNHFLDNRVLGKTSIAPGNTVYSPAVRQAASPVALDPDW
GPLQPVFDPPARYSAREAQKLAQLVNRLQVLLRAEIARRRDLEARLIAARLLEGPTAD
Download sequence
Identical sequences Q7NDJ3
NP_927188.1.44878 251221.gll4242 gi|37523811|ref|NP_927188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]