SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523849|ref|NP_927226.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37523849|ref|NP_927226.1|
Domain Number - Region: 160-253
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.016
Family Tetracyclin repressor-like, C-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 85-157
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0294
Family Pyruvate oxidase and decarboxylase PP module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37523849|ref|NP_927226.1|
Sequence length 260
Comment hypothetical protein glr4280 [Gloeobacter violaceus PCC 7421]
Sequence
MHPVFLGTFASLIAGLATAVGALPVLFARKLSQKTQSILLGFGGGVMLAASAFSLIVPGT
DIAVKQGYSRPVAALIMAVGILLGGLFLWLANRYFPHEHFIKGPEGANPSPERLKRIWLF
VGAIALHNFPEGMAVGVSFGGGSIAEGLPVAVGIGLQNMPEGLVVAVALLGQGYSVGYAL
WVTLLSGLVEPIGGLLGASVVSVSQAILPWGMAFAAGAMLFVISDEIIPESHRQGFDLEG
TVGVMVGFVVMMFLDIALGS
Download sequence
Identical sequences Q7NDF5
NP_927226.1.44878 251221.glr4280 gi|37523849|ref|NP_927226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]