SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519679|ref|NP_923056.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519679|ref|NP_923056.1|
Domain Number 1 Region: 40-305
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.33e-72
Family Alanine racemase-like, N-terminal domain 0.00000995
Further Details:      
 
Domain Number 2 Region: 280-439
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.98e-52
Family Eukaryotic ODC-like 0.0000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37519679|ref|NP_923056.1|
Sequence length 444
Comment diaminopimelate decarboxylase [Gloeobacter violaceus PCC 7421]
Sequence
MPADIPSPNQMIAPLETRTDARGHLMIGGCDVVDLAQRFGTPLYILDEATLRAACTQYVE
AFKRHYAGDFRVLYASKAWSNLAICAIVHRCGLGIDAVSAGEVHTALRAGVPGELVYLHG
NNKSEAEILLAAEVGATVVADNWLDLEILSAISAECPVRVMVRVAPGIDIHTHEYIRTGH
LDSKFGFDPSELAAVLAYLARIPSLRAVGLHAHIGSQSFELAPHGDAAQLLLEWYPKALA
LGLSDFNELNVGGGLGIRYTDDDDPPAIDEWVGTICQAVTRTCNTYNLPLPKLLCEPGRS
LVGPACATAYTVGSTKTIPSIRKYFSVDGGMSDNPRPITYKALYTAVVANKMHDGRREKV
TVAGKHCESGDVLLRDVELPPLERGDCLVVFSTGAYNCSMASNYNRIPRPAAVLVSDGEA
TLIVKRESPDDLLRCDCLPERLQT
Download sequence
Identical sequences Q7NPE5
NP_923056.1.44878 251221.gvip012 gi|37519679|ref|NP_923056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]