SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0243423 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0243423
Domain Number 1 Region: 27-195
Classification Level Classification E-value
Superfamily MIR domain 3.4e-58
Family MIR domain 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0243423   Gene: FBgn0216286   Transcript: FBtr0244931
Sequence length 212
Comment type=protein; loc=scf2_1100000004943:join(12740514..12740574,12740717..12741294); ID=FBpp0243423; name=DwilGK14280-PA; parent=FBgn0216286,FBtr0244931; dbxref=FlyBase:FBpp0243423,FlyBase_Annotation_IDs:GK14280-PA,GB_protein:EDW84749,REFSEQ:XP_002073763,FlyMine:FBpp0243423; MD5=7d71457473e4a8c3c9f70b7e3948fdd3; length=212; release=r1.3; species=Dwil;
Sequence
MLNLLVLTCLSIISCLPSYQATQTNVVTCGSILKLLNSDYNFRLHSHDVKYGSGSGQQSV
TGVEQKEDVNSHWVIKALTNELCERGEPIACGNTIRLEHLSTKKNLHSHHFSSPLSGEQE
VSAYGTDGLGDTGDHWEVVCSNEKWMRDAHIRLRHIDTGMYLGMSGRSYGRPISGQMEIV
GVHNPRHGTRWTTAEGLFIVPKDQDQLTHDEL
Download sequence
Identical sequences B4NI57
7260.FBpp0243423 XP_002073763.1.14588 FBpp0243423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]