SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0244475 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0244475
Domain Number 1 Region: 242-448
Classification Level Classification E-value
Superfamily MIR domain 8.72e-58
Family MIR domain 0.000000203
Further Details:      
 
Domain Number 2 Region: 449-619
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.88e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000716
Further Details:      
 
Domain Number 3 Region: 1230-1386
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.57e-34
Family IP3 receptor type 1 binding core, domain 2 0.0079
Further Details:      
 
Domain Number 4 Region: 111-223
Classification Level Classification E-value
Superfamily MIR domain 0.000000000000602
Family MIR domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0244475   Gene: FBgn0217337   Transcript: FBtr0245983
Sequence length 2843
Comment type=protein; loc=scf2_1100000004521:join(6603264..6603364,6603441..6603511,6603591..6603706,6603775..6604561,6604613..6605847,6605987..6606162,6606221..6606376,6606440..6606593,6606654..6606807,6606874..6606900,6606969..6607600,6608312..6608594,6608662..6608885,6608964..6611756,6611814..6612006,6612074..6612196,6612463..6612635,6612735..6612899,6612960..6613361,6613423..6613989); ID=FBpp0244475; name=DwilGK15332-PA; parent=FBgn0217337,FBtr0245983; dbxref=FlyBase:FBpp0244475,FlyBase_Annotation_IDs:GK15332-PA,GB_protein:EDW76206,REFSEQ:XP_002065220,FlyMine:FBpp0244475; MD5=54de801e6a7c37c8f6a7437ee6c76b1a; length=2843; release=r1.3; species=Dwil;
Sequence
MGDNLIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLTCPPKKFRDCL
IKICPMNRYSAQKQFWKAAKQSASSNTDPNLLKRLHHAAEIEKKQNETEHKKLLGTSIQY
SRAIVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYV
VVGDKVILSPVNADQQNLHVAANYELLDNPGCKEVNVLNSSTSWKISLFMEHKENQEHIL
KGGDVVRLFHAEQEKFLTMDEYKKQYHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRG
GAGDWNSLYRFKHLATGHYLAAEAELDIVAAGAASSSSAQEPFLAECSKDSSLNYALNDK
SKGKQYRLVSVPYSADIASVFVLDATTMARADSLVPQSSYVRLQHICSNTWVHATSIPID
ADDDKPVMSKVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKLLAIVTTKLDNGSISI
NERRSLISLLQDIVYFMAGMENEQNKTKALEFTIKNPIRDRQKLLREQYILKQLFKILQG
PFQEHTAGDGPFLRLDELNDPKNSPYKNIFRLCYRILRLSQQDYRKNQEYIAKHFGLMQK
QIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMDNWDSRFLDYLSDLCVS
NRKAIAVTQELICKSVLSDKNADILIDTQVKALKGGSAIVSCYKGATEDLCLATLTEVAG
DGDEDRSEDVQSTSTTNTNWDSVSLNDDEDSSLMASNEKYEIHLQWKGQPSSRSMADLAN
CVADGGEQEAAILNYYRHQLNLFSNMCLNRQYLALNILSPHLDIDLILKCMSDETMPYEL
RASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPSKMSILDYDGKNQQPDQNKQACRAKF
NTTIAFVENYLCNVATKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLS
ILDCVSETNAGNSGGSYVNTDIDSNEEETNTQAEGGVLRSIGDMNTVMTSLALGSMGQAI
AAPAIALQQRKSVSQLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDES
DVVPQDEIVLGVPVVTKDEPKLSNNTESEPLLGNAGEPTDPATANARQKNIDLESIGIKA
EGIFDCERSDAANLDLDGQGGRTFLRVLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQA
FRQVQLLVSDSDVETYKQIKSDLDILRQSVEKSELWVYKAKATDELGGNSGGGSGGGDVS
GDAANLEYNAALSPDQRNEYKKVKDILIRMNQYCVTVGPVVKPRKHEQRLLRNVGVHTVV
LDLLQNPYDEKDDVLMKELMCLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAKTVC
AIFKDNLALCNEVTDKVVQHFVHCIEIHGRHVAYLQFLQTIVKAENQFIRKCQDMVMQEL
INSGEDVLVFYNDKTSFNHFVQMMQQHHLSRQPLSDDSPLKYHVELVKLLACCTMGKNVY
TEIKCNNLLSLDDIVTIICHPLCMPEVKEAYVDFLNHCYIDTEVEMKEIYASGHMWNLFE
KSFLVDIHQLISHPSIANSNKNLLSYVLNGLMNLLSSFFSSPFSDQSAIVQSRQLIFVQL
LQAAYRLTQCKWLSLADRFNVEMCIRTLSESAKMRSITLPLELEQQVATMSNKTAMLTRQ
TTKWLLASKQPKYETQQSASLMRWDRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYR
SELLFPAGTEARKRCESGGFIRKLIKHTEKLLEEKEERMCVKVLRTLREMMAIDVNYGEK
GDALRQTLLKRYFQNKSSFKVEEEIEAPPSPPTDPAKQLHLVTHGPGAKYLQRAGKTLHE
MQNHLDREGASDLVVELVIKSVHSPNIFVEAVELGIALLEGGNPIIQKGMFQKFLSDDLN
QAFFKVFFDKMKDAQQEIKSTVTVNTTDIAAKAHEHKQDANLELLDKISRKHGLKRNGVV
ITEELKRELHNAGLATARAYGNARIIHSGEENSQMISVNSPLEDILAEKLEKHKDGKEQR
RNQLSNKVLVMQPILRFLQLLCENHNPDLQNLLRNQNNKTNNNLVSETLMFLDCICGSTT
GGLGLLGLYINEHNVALINQTLETLTEYCQGPCHENQNCIATHESNGLDIITALILNNIN
PLGENRMDLVLELKNNASKLLLAIMESRGDSENAERILYNMNPKQLVEVACKAYHQEELI
DEQDDADDQADSTSGVVDDDDDDATVSPREVGHNIYILCHQLAQHNKELASLLKASEDPQ
SSSFDAKTSQALMYYATHTAQIEIVRNDRTLEQIVFPIPEICEYLTTDTKIKILNTAERD
DQGSKVADFFDKAEEMFNEMKWQKKLRSQSLLFWISSYMSLWSNILFNCVVVINMIVAFF
YPFDNTVPELSAHISLLFWAIMIFSLIIVITLPRESGIRTLIGSMILRFIFLLGPESTLC
LLGIVTVTLKSVHIVSIMGNKGTLEKQLIKIVTDFQLLYHCIYIAFCFCGLILHPFFYSL
LLFDVVYREETLVNVIRSVTRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFLVPVDFEE
QEQTISVLSTDESCAAPDKLGSICEAKTKQLTAENSNDVKERACDSLVMCIVTTLNQGLR
NGGGIGDILRAPSSKEGLFVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKE
AILKTTCFICSLNRSAFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVY
AMVKAGILEWFPRLRAMSLAAVDADGEQIELRSMQVQLLETQLLIKNLSTQLHELKDHMT
EQRKQKQRLGLLNTAANSLLPFQ
Download sequence
Identical sequences B4MUL1
7260.FBpp0244475 FBpp0244475 XP_002065220.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]