SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0253065 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0253065
Domain Number 1 Region: 1205-1228
Classification Level Classification E-value
Superfamily DPY module 0.00000248
Family DPY module 0.0012
Further Details:      
 
Domain Number 2 Region: 990-1013
Classification Level Classification E-value
Superfamily DPY module 0.00000275
Family DPY module 0.0014
Further Details:      
 
Domain Number 3 Region: 1100-1123
Classification Level Classification E-value
Superfamily DPY module 0.00000327
Family DPY module 0.001
Further Details:      
 
Domain Number 4 Region: 655-678
Classification Level Classification E-value
Superfamily DPY module 0.00000458
Family DPY module 0.0012
Further Details:      
 
Domain Number 5 Region: 1528-1551
Classification Level Classification E-value
Superfamily DPY module 0.0000106
Family DPY module 0.0013
Further Details:      
 
Domain Number 6 Region: 1327-1481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000143
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 759-782
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.0012
Further Details:      
 
Domain Number 8 Region: 898-1053
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000377
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 1634-1656
Classification Level Classification E-value
Superfamily DPY module 0.0000589
Family DPY module 0.0019
Further Details:      
 
Weak hits

Sequence:  FBpp0253065
Domain Number - Region: 1726-1748
Classification Level Classification E-value
Superfamily DPY module 0.000127
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 1793-1816
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 2292-2315
Classification Level Classification E-value
Superfamily DPY module 0.000811
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 1915-1938
Classification Level Classification E-value
Superfamily DPY module 0.00157
Family DPY module 0.003
Further Details:      
 
Domain Number - Region: 1065-1162
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 2937-2959
Classification Level Classification E-value
Superfamily DPY module 0.00248
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 1311-1334
Classification Level Classification E-value
Superfamily DPY module 0.00301
Family DPY module 0.003
Further Details:      
 
Domain Number - Region: 3128-3148
Classification Level Classification E-value
Superfamily DPY module 0.00497
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 2164-2185
Classification Level Classification E-value
Superfamily DPY module 0.00732
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 848-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 3190-3212
Classification Level Classification E-value
Superfamily DPY module 0.0102
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 2503-2523
Classification Level Classification E-value
Superfamily DPY module 0.0102
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 3011-3031
Classification Level Classification E-value
Superfamily DPY module 0.0119
Family DPY module 0.0025
Further Details:      
 
Domain Number - Region: 2436-2457
Classification Level Classification E-value
Superfamily DPY module 0.0131
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 3067-3086
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.003
Further Details:      
 
Domain Number - Region: 1273-1307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0197
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1857-1877
Classification Level Classification E-value
Superfamily DPY module 0.0222
Family DPY module 0.0039
Further Details:      
 
Domain Number - Region: 2684-2706
Classification Level Classification E-value
Superfamily DPY module 0.0248
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 2814-2834
Classification Level Classification E-value
Superfamily DPY module 0.0288
Family DPY module 0.0044
Further Details:      
 
Domain Number - Region: 2454-2487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.031
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 2618-2641
Classification Level Classification E-value
Superfamily DPY module 0.0327
Family DPY module 0.0042
Further Details:      
 
Domain Number - Region: 1979-2000
Classification Level Classification E-value
Superfamily DPY module 0.0445
Family DPY module 0.004
Further Details:      
 
Domain Number - Region: 1490-1522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family EGF-like domain of nidogen-1 0.094
Further Details:      
 
Domain Number - Region: 2875-2895
Classification Level Classification E-value
Superfamily DPY module 0.0536
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 2755-2777
Classification Level Classification E-value
Superfamily DPY module 0.0615
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 1595-1627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0253065   Gene: FBgn0225884   Transcript: FBtr0254573
Sequence length 3792
Comment type=protein; loc=scf2_1100000004516:join(2706639..2706890,2709671..2712257,2713293..2713958,2714029..2714964,2715060..2716714,2717046..2717246,2717326..2717520,2717593..2718583,2718642..2721866,2721941..2722369,2722432..2722673); ID=FBpp0253065; name=DwilGK23922-PA; parent=FBgn0225884,FBtr0254573; dbxref=FlyBase:FBpp0253065,FlyBase_Annotation_IDs:GK23922-PA,GB_protein:EDW75560,REFSEQ:XP_002064574,FlyMine:FBpp0253065; MD5=28de6ac3ea07947460167222532d627b; length=3792; release=r1.3; species=Dwil;
Sequence
MVRDHASVFQISTAILMRAADLNVFLTLIVQVIWPVLISIVAIHVLAAVDLMHNARLSIM
CPIADVIPALMVTLTNIAISIKQNPLPVHPTPQPGVVNIPSVPQPLPPSPHPSVVNIPSV
SQPVHPTPQPGVVNIPSVPQPLPPSPNPSVVNIPSVPQPVHPTPQPGVENIPSVPQPLPP
SPNPSVVNIPSVPQPVQPPTQPPVYDVYNPTTPLPIPQQPGVVNIPSVPQPAHPIPLPGV
VNIPSVPQPLPPSPNPSVVNIPSVPQPVHPTPQPGIVNIPSVPQPLPPSPHPSVVNIPSV
SQPVHPTPQPGVVNIPSVPQPLPPSPNPSVVNIPSVPQPVQPTTQPPVYDVYNPTTPLPN
PQQPGVVNIPPVPQPAHPIPLPGVVNIPSVPQPLPPSPNPSVVNIPSVPQPVHPTSQPGV
VNIPSIPQPLPPSPNPSITNIPSTPTPANPPVEERPAIYDVYYPPPPSTPGVINIPSPRP
VYPISQQPIYIPNSEPIKPAPNVFNIPATLRPTYPPQKAPVNDISYPTSEPPKPGVINIP
SLPQPAPQPSHPPSFIPTPTPAYVPTPRPEVINIPSITKPPQPSPGIVNLPSAPPTPAVL
QTTTPRPVFDIGIPVPEGNPCYPSPCGPFSQCHNRFGIASCICLPNYSGTPPNCRPECTV
HSDCPLHLACINEKCRDPCLGSCAYNAICRVYNHVPNCFCDVGYTGDPFVSCHRAPVLSE
LIQPKDPCYPSPCGANAICNNGVCSCLPEYQGDPYVNCRPECILNTDCAKNKACKQQKCR
DPCPGTCGLNAVCEVYNHVASCSCPEQMQGDAFIQCYSIPQPVPTQPPKITAIVSTTSLP
AVVPQRTPINPCYPSPCGPNANCRPYHEQAICYCLPGYLGIPPTCHPECTTHSDCSLDKY
CLNLRCEDPCPGACGHRAVCHVQNHSPICVCPTGLTGNPLIACQPIATPPVYVNPCQPSP
CGANSQCRESQGQAICSCLPSFVGTPPSCRPECVISTECSADKACINQKCQDPCPGTCGI
NAQCHVRNHSPLCTCLPGYTGEAFTRCLPMPPPKQVKPTADPVDPCLPSPCGPYSQCRQV
NGGASCSCLPNYIGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAATCNVINHT
PSCSCPVGYTGDPFSSCRPQPPPPTEVKTPKDPCNPSPCGANAICRDGQCSCQPEYQGDP
YTACRPECVLNSECPRNRACVRNKCVDPCPGTCGQNALCDVVNHIAMCRCPERMTGNAFI
ACSPIRDEIPSQPPNPCQPSPCGTNAQCIERNGNAVCSCITGYFGQPPNCRVECYTSSDC
SQVHTCINSKCVDPCPGRCGLNAVCQAVQHRAHCECVAGYTGNAYSLCSLIVVERKPETA
RDPCYPSPCGPNSQCRNENGQAQCSCLAEFQGTPPNCRPECVNNDECAANLACINQKCRD
PCPGSCGQNAQCTVTLHTPNCHCPAGMTGDPFRLCHPLPQNLPTPSPQPENPCYPSPCGT
NAECRVRGHNYVCECLQEYIGNPYEGCRPECVGNSECPANRACIRNKCADPCPGTCGLEA
ICTINNHLPICSCPAGFTGNAFEQCTRLVTPPPPSDPCYPSPCGLNSVCRVQRDQAVCEC
LPGFFGNPLGQGCRPECTLSSDCAKDRACVNSKCVDACTGVCGYGAVCQTINHSPICSCP
GDMVGNPFVQCEQPRQAEPVDPCNPSPCRSNGICRVVNGAATCSYPECVTNEDCSRDRTC
VSQKCRDPCLHACGLNAICRAVNHKAVCSCPPEFYGSPYAQCVRQEPELKPVKPECVSDS
ECTNDKACINQVCRNPCEQSNLCAQQARCHVQLHRPLCVCNEGYTGNALQYCYLVGCRSD
GECAPTEACINEKCVDPCSFTQCGVGAICRADFNHRARCHCLDGYRGNPLVRCNRPECRS
DDECSFNLACRNEHCEDPCNCGIGAQCRVDNHRAQCRCPAGFSGNPAVRCDLVPQQPEGC
TMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMICRCEPGYNPQEIKAA
LRMINVRIQKPVAAVFVLILVWKLHHVHVQPNVLPSIIVLFAVAHKAHKEIRSPTAMSHH
KSQLDVHMTQNVHQQQPASINVAKIHVLRPILVPEMLNAVYRIHVQYVIVLLAGVVILKF
NAINCKINADCPYDKACLNENCVNPCTYSQVRCGIGAECLPQNHQAVCSCPAGTQGNPFV
TCITGHCQYNEDCADHEACDRLNRVCRPVCEQDTCALNALCVGRRHQPQCECRAGYQGNP
LVQCDLPQRIPQPQCTQDAECPSKLACINQRCSNPCATPHVCSPQQSCSVLDTLPLRTMI
CKCPSDTVTDNSGNCVPIKTPVVTVGCQHNSECANPEVCLHGSCLDACRLEKCGFNAQCT
ARDHYAQCSCPPGYQGNPRIECSTKDIALPKIPGAECTRNDDCPEEKICRNERCINPCVA
DPCGRGAYCHVQQRAAICRCPPGYTGNPKERCLPPSDVITVGCKANSDCPVSEACINAQC
VNPCNCGPNAECTVRNHHPICYCKPGFSGNAQFGCAPIGCQSDDECSGDKQCLNRECVNP
CLVTDPCALNAECFGRNHRANCRCPTGLEGDPFVRCLRLECHSDYDCATNLACVSNQCVS
PCAPSPCAQNAVCQALQHRANCHCPEHLPLGNPFAYCEPRPVEPVCRDDGDCPSGLACID
AKCQNPCTELSPCARSAQCSVLDSVPVRTMVCQCPEAQVPDASGECRKLVLQSPPGCETD
HDCPDQEACIHRQCRNPCNCGTNAICQVTQHRAVCSCQDGFEGNPYAACRSIGCRSDDEC
SFNKACINANCIDPCLINDPCGPNAECYVQSSRAQCRCLSGFRGDPYERCRVIGCSSNND
CPTDKTCQNEQCVNPCIYHNPCSPRAECRPQNHIAVCRCPTNYLGNPYVDCRPQPQPVCQ
LDTDCPSLQACINEQCVDPCLVLEPCQRPARCQVTPTAPVRTMICICPDGYISSGSGSCK
PTTSIVKIGGCVSDSDCPADKSCLNGICRDPCNCGLNAECRIKDHKPICTCRQGYEGNPE
FECSKIECTINSECPATHACRNQLCVPACQGEQCGPNAECLAVNHRAVCECAPGHGGNAR
LGCTPLGCRTDDECPTDRACVNGKCADPCETTAICASDERCKVYQHKPQCACPPGTIPGR
NGCEQERVVPICISDADCPTQRACLRGECVNPCNATQPCGVNAECRVLDTLPVRTMICEC
LEGYTGNAAVQCDKRSLCVIEKGFIRDNDGQCVCPPGTALDVYEYCTPCLIEQGYRITEN
GRCECALERGMVIDERGRCTCPIELGYRLTPQGECQPVEQPECVTDDQCADNRYCNTETK
TCEDPCLIKTCGVNAFCNAVNHRGQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLA
DGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKD
VASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQ
MRIITNEGEEINSAEIGDNLKLQVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGC
ATDASIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGR
RRRAIADNSTNDPTAIATSTGVEGQLREEITISSNAILTFEKRSGPGLNDANIKPAAQRV
EDICVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKTLAPLPHPPEFPNPLFANP
DAVPEPTPDYIS
Download sequence
Identical sequences FBpp0253065 7260.FBpp0253065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]