SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0239823 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0239823
Domain Number 1 Region: 1111-1237
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-17
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0239823   Gene: FBgn0212693   Transcript: FBtr0241331
Sequence length 1249
Comment type=protein; loc=scf2_1100000004382:complement(215418..216152,216214..216512,216579..216924,216983..217231,217297..217467,217537..217681,217869..218055,218117..218500,218571..219489,219567..219863,219964..219981); ID=FBpp0239823; name=DwilGK10680-PA; parent=FBgn0212693,FBtr0241331; dbxref=FlyBase:FBpp0239823,FlyBase_Annotation_IDs:GK10680-PA,GB_protein:EDW71985,REFSEQ:XP_002060999,FlyMine:FBpp0239823; MD5=3661837ef8ed3bfde65ec816df5b5e59; length=1249; release=r1.3; species=Dwil;
Sequence
MDPFTQQMLEKAEQRSRALGISNTSKFPLAECSVDTDASPSNVKPTPAVRSHSPGGGSSS
GKVVVLDKATLEASPSKPLRHYAAVNKENMEMGIEINITTDKPIGVQVEIQEQDVTTDED
EDPATVTAPVQSLPVNQPLARLRDTSRNRLQRMGALYSNTDDLSSPIHRTEAQFHAGDDD
VDTEQPPSSRQGKQRFGKLAALADTINQWEDDLSHHDRPKSEQERPVTTAPPKPDLPSRR
PVVRPPQPPKPEEVDQGLKTKQLKWDPKVLSSLEAQGFQRRESSTIKHTYDYAKQEEKSE
KPEKPEKTTSTKTVSQVAKTFNTTHSKPPAPAPPTTTGVKTGLVSGRAAIFENKASSGGQ
LTGRSNQKDPCELSLKDRMKLFETASAVAMLPKAPISSAPSISQIRPEEHKAAAVHPVTA
AAAVSVPNGGGNKPAKPENKLRDKVAALVANAQSTAESRIKDIDRQRQEDMQIIANRFNK
QKDAFTLATAPPPPAPIPAPTVASVRISRPMPPPPPPPIAGLVHNTNKICSITSSKRRSP
GDTVIHENEEDQEEAKRARKSQPDRLYPALSDLDSSGDNCCATVTASATDNDNDSNSEEL
DSCMDDEESQTETEAEDSSAGMCNGSLGREILNAVQRNEVEQQQQSTKKKTVHYADRDYY
YHHEEDSSLNSSQVSGGIDDYLDEALDDDDETTDDNADHNASGLSLNSKGTTASNSFSYR
KTPAAVAMNVDEEPLHLADTMYQTPSMVVTDNGNHPVPVKSELSVNQDNDNNLVTLVHTV
SFYRRQQSANSTNSTPMRKICREEQVARSALAGDCHAKHKLEYDSPLPAGATEVRSEDDE
DETDSEVQSNDAAQAQDKIKKLLSEVCKQQQVIGQASQALNLCAATVEFSGSTESVEGER
YLLLATHRRQACLDEVQRLRVENSLRPVGAPKEKGLLTVKDITIPLRQEYVRKMATGNIN
GHHLVCLLKYNEHVLATKTVPTMPGLLSVKFPDVLQLNNVYADFRITLEIYGMLAQRDQL
PHELKYHINLNKKSGSGVLKTPKKKSGENRLVMPPVQSPAGPHVVRTPQLVQYGFAIFSL
REIQRTSWTLTQVLGVSPLEGVVHMKVNCELSVCVEYKGFLTMFEDISGFGAWHRRWCYL
NGSVINYWKYPDDEKKKAPMGSIDLNTCISQKITTAPRDICARLNTMLLECERPAKDTDQ
ESLIIVPNGRMTTVRHLLSADTREEREEWSAYFNKALTLLRAWGTNSTH
Download sequence
Identical sequences FBpp0239823 7260.FBpp0239823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]