SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0242580 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0242580
Domain Number 1 Region: 339-611
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.88e-42
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 161-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 250-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000985
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 68-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 6 Region: 120-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  FBpp0242580
Domain Number - Region: 304-355
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00101
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0242580   Gene: FBgn0215445   Transcript: FBtr0244088
Sequence length 627
Comment type=protein; loc=scf2_1100000004943:complement(5161437..5161941,5162008..5162539,5162611..5163086,5163151..5163454,5163775..5163841); ID=FBpp0242580; name=DwilGK13437-PA; parent=FBgn0215445,FBtr0244088; dbxref=FlyBase:FBpp0242580,FlyBase_Annotation_IDs:GK13437-PA,GB_protein:EDW83898,REFSEQ:XP_002072912,FlyMine:FBpp0242580; MD5=5ce75e7f9185c12f9002f1432c17358d; length=627; release=r1.3; species=Dwil;
Sequence
MSSGGLLLIVFLGYFLCLRLTPTNAACSTLQFECDNGSCISKFDICDGVKNCPDGSDETA
MTCVNQRQHCSKPYFQCSYGACVIGTAGCNAQVECADGSDETLLRCGTEDDIREFNRRLQ
GNCQSNEIKCPSGICIDKNKSLCDGKDDCGDGTGFDESVGLCGHTDCPGYSFKCGTGGCI
SGSLSCDGKTDCFDGSDEAPLLCNTTRSMTSAPPVVTIEQVGCPLALGDERPILKDHIGR
LLTPPINKVTVHFSCESGFTLEGQESSHCANRKWSVAPPKCVRYCDSRGKFDGYSTKATC
TKDGQLVDCNKRYHPPGTEVKFVCATGFRSLLKTTLPDMKCMWGGYWNRDRERCEQECGE
IATPTKSFSAFGYSVNNTVVPWHVGIYAWHNEKDYNFICGGSLLTPDLVITAAHCVFDEA
TRRIYSFSTFRVIAAKFYRNYKNVTDEERRVDVQNIIVAPDYQGSTDNFYNDLALMILEK
PLELSNVIRPICLKFSHNAEKESINNDVQGKFAGWSIADKHELQFVPALSKMNSVCRDNI
KDIRSDKFCIFTQGKSLACQGDSGGGFTAERQYTENAQVTHRHFLYGVISNAPNADQCAH
SLTVLTNIQHFEYMINREYQLSVEGRS
Download sequence
Identical sequences B4NJH4
XP_002072912.1.14588 7260.FBpp0242580 FBpp0242580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]