SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0244383 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0244383
Domain Number 1 Region: 816-1006
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.57e-64
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000243
Further Details:      
 
Domain Number 2 Region: 42-414
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.92e-53
Family L-arabinose binding protein-like 0.0035
Further Details:      
 
Domain Number 3 Region: 510-801
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.99e-50
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0244383   Gene: FBgn0217245   Transcript: FBtr0245891
Sequence length 1108
Comment type=protein; loc=scf2_1100000004521:join(4644699..4644866,4652079..4652212,4652290..4652401,4652658..4652732,4652825..4652932,4653497..4653620,4653685..4653834,4653908..4654016,4654588..4654615,4655625..4655777,4655838..4656019,4656101..4656209,4656264..4656330,4656391..4656488,4656542..4656852,4656921..4657090,4657150..4657339,4657406..4657546,4657614..4657709,4658784..4658880,4658935..4659141,4659192..4659350,4659404..4659742); ID=FBpp0244383; name=DwilGK15240-PA; parent=FBgn0217245,FBtr0245891; dbxref=FlyBase:FBpp0244383,FlyBase_Annotation_IDs:GK15240-PA,GB_protein:EDW76011,REFSEQ:XP_002065025,FlyMine:FBpp0244383; MD5=39cbecfae67e1b5b7c5631deaa912d95; length=1108; release=r1.3; species=Dwil;
Sequence
MQVIHLILVAIVLGLLCQDNQRPATASAAAAATTTTTRRISDTINIGFLAEYSHLRVTLG
GLPLAVKDVNKNPDLLPGKTLSFKNVDIGHKMSAYRVKPLRLMTEMRDAGVTAFIGPAES
CTTEALLASAWNMPMLSFKCSDSIVSNKSTFHTYARTLAPASKVSKSVISLLNAFHWKKL
TIVVSSKPIWGSDVARAIQELAESRNFTINHFKYISDYIPIKKTLSQIEKIIEETYSTTR
IYVFIGEHIAMVDFVRGLQNRKLLESGDYIVISVDDEIYDSNRRVNIMERNYLDPYIRKE
KSKSLDKISFRSVIKISMTYPQNPHIRSYHSIQGFDVFIDSNGDAEGNYTVITLQNDFSS
SANHGSLAKMSMLPVGYFVYNKNSPIPEFRYIKNDRPIQWLNGRPPLAEPLCGFHGELCP
RKKLDWRYLATGPLFALVLIVAIALLVKHYRYEQTLAGLLWKVDMKEVTVINLGEYNNPS
HKNIFQICRQSILVVGEPNKRSFTNIALFRGNIVAMKKIHKKHVDITRSIRKELKLMREV
RHENIINFIGASLEHGSVIIFTTYCARGSLEDVLANEDLHLDHMFISSLVSDILKGMIYL
HDSEIISHGNLRSSNCLIDSRWVCQISDFGLHELKSGEEEPNKTELELKRALCMAPELLR
DSYRPARGSQKGDVYSFGILLYEMIGRKGPWGDTTYSKEEIIKFVKCPELLQHGIFRPAL
THTHLNIPDYIRQCLRQCWEEDPEIRPDIRLVRMRLKELQAGLKPNIFDNMLAIMEKYAY
NLEGLVQERTNLLYEEKKKTDMLLYQMLPKTVAELLKRGDPVEAECFDCVTILFSDIVGF
THLCTTSTPFEVVEMLNDLYTCCDSIISNYDVYKVETIGDAYMVVSGLPLHNGNRHAGEI
ASLALHLLEHVGNLKIQHKPTETMQIRIGIHSGPCAAGVVGQKMPRYCLFGDTVNTASRM
ESTSESMKIHISEETYQLLVTIGGYACIERGLTNIKGKGDMRTYWLTNRTQSELAPDLIS
TVDTLDTHCSMTMSMMSQFRNTGSCNCATKCLYSRRSDDNVTHEPQSLQKITAPTQINCN
QLCVCRLNGSQALSNRSPRSAPSITFRL
Download sequence
Identical sequences 7260.FBpp0244383 FBpp0244383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]