SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0245036 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0245036
Domain Number 1 Region: 413-748
Classification Level Classification E-value
Superfamily L domain-like 4.93e-50
Family Internalin LRR domain 0.05
Further Details:      
 
Domain Number 2 Region: 112-436
Classification Level Classification E-value
Superfamily L domain-like 1.59e-46
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 3 Region: 832-1006
Classification Level Classification E-value
Superfamily L domain-like 5.83e-29
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 4 Region: 1089-1236
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-22
Family Toll/Interleukin receptor TIR domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0245036   Gene: FBgn0217896   Transcript: FBtr0246544
Sequence length 1441
Comment type=protein; loc=scf2_1100000004514:1906019..1910344; ID=FBpp0245036; name=DwilGK15893-PA; parent=FBgn0217896,FBtr0246544; dbxref=FlyBase:FBpp0245036,FlyBase_Annotation_IDs:GK15893-PA,GB_protein:EDW74839,REFSEQ:XP_002063853,FlyMine:FBpp0245036; MD5=81c21737e6c363556ce7ee4f7e5305a8; length=1441; release=r1.3; species=Dwil;
Sequence
MEQTVLLLLLLPLMVVMMSGSRAALVPKERGNSDNSASAMLGGGAGAATVSLSSDYSSLL
SAAVPVASSPAPVHSGPNNQCSWTYNGTSAVHCALRLIERQPGLDLQGADGSSQLTIKCS
DLYMFESTLPVAVFARLQTLESLRLESCKLLQLPNNAFEGLTTLKSLRLSTRNGEWGPSK
ALELYPDSLNGLKQLTELDLSENNLRALPAGFLCPVGNLQSLNLTRNRIRTAEQLGFADM
NCSGGSELQLLDASHNELRSITESWGISRLRRLQHLNLQHNNISELSGEALAGLSSLRIV
NLSNNHMETLPEGLFAGSKELREIHLQHNELYELPKGLFHRLEQLLVVDLSGNQLTSNHV
DNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLH
TLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEV
PRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFADLPRLSV
LNLAKNRIQSIERGSFDKNFELEAIRLDRNFLSDINGVFATLVSLLWLNLSENHLVWFDY
AFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFIN
NNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVLAPKPLPEFYLGGNPFECD
CTMDWLQRINNLTTRQHPRVMDMPNIECVMPHARGAAVRPLSSLRPQDFLCRYESHCFAL
CHCCDFDACDCEMTCPHNCTCYHDQIWSTNVVDCGGQQTMELPRRVPMDSSIVYLDGNNF
PVLKNHAFIGRKNLKALYVNGSQVAGIQNRTFASLASLQLLQLADNRLQVLHGYEFEQLS
SLRELYLQNNQLTTIENATLAPLVSLEVLRIDGNRLVTLPIWQMHATHFGKRLRSISLGR
NQWSCRCQFLQALTSYVSDNAIIVQDAQDIYCMAASNSANYDVDAYDANGSQGTLQKREL
DFNSTGAACTDYYSGGSMLQHGIPESYIPLLAAALALVFLLVVIIIVFVFRESLRIWLFA
HYGVRVFGPRCEESEKLYDAVLLHSAKDSEFVCQHLASELETGRPPLRVCLQHRDLAHDA
THYQLLEATRVSRRVVILLTRNFLQTEWARCELRRSVHDALRGRPQKLVIIEEPEVAFEA
ESDIELLPYLKTSAVHRIRRTDRHFWEKLRYALPVDYPTYRGNNYTLDHNHERIKQPASP
GLLYRQAPPPAYCGPAEGGPAAAAAAAAAVEQNYSTATTATPSPRPQRRGDHQGGGGSGS
SSHGHHLHAQYYQHHGMRPPSEHIYSSIDSDYSTLDNEQHMLMMPNGPPSMEGQRAQTWR
PKQQQQQQQPPNAMGHAGTLGPSSNLAKATSQQQQQQQQQQQQQPTGSGQQQGPHVQAYL
V
Download sequence
Identical sequences B4MRV0
FBpp0245036 7260.FBpp0245036 XP_002063853.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]