SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0249177 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0249177
Domain Number 1 Region: 98-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.79e-30
Family NodB-like polysaccharide deacetylase 0.02
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 4.18e-16
Family Tachycitin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0249177   Gene: FBgn0222031   Transcript: FBtr0250685
Sequence length 487
Comment type=protein; loc=scf2_1100000004515:join(2178384..2178435,2185690..2185781,2185845..2185956,2193512..2193639,2200650..2200792,2214382..2214601,2215571..2215956,2218856..2219186); ID=FBpp0249177; name=DwilGK20034-PA; parent=FBgn0222031,FBtr0250685; dbxref=FlyBase:FBpp0249177,FlyBase_Annotation_IDs:GK20034-PA,GB_protein:EDW75178,REFSEQ:XP_002064192,FlyMine:FBpp0249177; MD5=194b1ee3dd7ad2f62e78c43f273648f8; length=487; release=r1.3; species=Dwil;
Sequence
MLQHCLIATLLLIVAVQGQNKEKEEFTCPSHIANGNYADPATCRRFYQCVDGYPYLNRCP
SGLYFDDVQKFCTFKDEAKCGPLPTTPAPATDAPADTAQRCNTEDCTLPYCFCSKDGTQI
PGDLDPAKIPQIIMLTFDGAVNLNNYDHYQKIFNGKRKNPNGCLIRGTFFMSHEYSNYQQ
IQHLAYAGHEIATESISQQQGLQDKGYEEWVGEMIGMREILRHFSNVSVSNVVGMRAPFL
KPGRNTQYKVLEDFDYIYDSSITVPPVSVPVWPYTLDYKISHECKSGTCPSRTFPGVWEV
PLNTHYVEGYEGGHCPYLDQCVLHNLDENEVLEWLQEDFSRYYEQNKAPYMMPFHTNWFQ
TKPLENGLHKFLDWALELPDVYILTVTQMLQYTTDPKELRDVNTIESWKCDKNIAVAPKP
CNIWQTCALPFKIPEQNLTDTRYMETCRECPNVYPWLGDAGGTGIAGKDNYINGGGSEEE
QTQETSK
Download sequence
Identical sequences B4MST9
7260.FBpp0249177 XP_002064192.1.14588 FBpp0249177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]