SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0249821 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0249821
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 8.24e-39
Family MIR domain 0.003
Further Details:      
 
Domain Number 2 Region: 1083-1180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-20
Family SPRY domain 0.025
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000261
Family SPRY domain 0.065
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4217-4279
Classification Level Classification E-value
Superfamily EF-hand 0.000000486
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 2254-2356
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000732
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0249821
Domain Number - Region: 452-630
Classification Level Classification E-value
Superfamily ARM repeat 0.00719
Family GUN4-associated domain 0.072
Further Details:      
 
Domain Number - Region: 1534-1658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0522
Family SPRY domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0249821   Gene: FBgn0222674   Transcript: FBtr0251329
Sequence length 5143
Comment type=protein; loc=scf2_1100000004510:complement(2713771..2716468,2716531..2716732,2716796..2717215,2717278..2717388,2717684..2717984,2718181..2718532,2720320..2720432,2720758..2722858,2722922..2723208,2723440..2723577,2723696..2724175,2724241..2726528,2726590..2726705,2726773..2726967,2727269..2728428,2728488..2729250,2729311..2729515,2730740..2730839,2731026..2731629,2731693..2733115,2733178..2733302,2733363..2733887,2733948..2734336,2734414..2734491,2735519..2735722,2737277..2737330); ID=FBpp0249821; name=DwilGK20678-PA; parent=FBgn0222674,FBtr0251329; dbxref=FlyBase:FBpp0249821,FlyBase_Annotation_IDs:GK20678-PA,GB_protein:EDW72492,REFSEQ:XP_002061506,FlyMine:FBpp0249821; MD5=81f82f10389942fd456ce51bbbdc2b50; length=5143; release=r1.3; species=Dwil;
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVVYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSNELIL
VKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITALE
TLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGS
SMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAYLWTGGRKTLVVDALVEEPYIRKGDVIGVAIDLAVPVITFTFNGIKVRGCFRDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKYAPPMGFSALVQCLMPHQILSLDPCFYFGNLNKN
VLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYHRIHPCLTQFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRLPNEI
FMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSDNHRS
PHLVPYGKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAAFRT
YRVERNYAVTSGKWYFEFEVLTAGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHA
GSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFAEVTAEGVGFVPAC
TLGVGQKARVIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMSEFISEQDKARRWE
EIKIRQYRLMREAEAAAAQAAQTQNAAHMDHMLKGGFNMNDIKGLTRNFDDHTEAEAEHM
MRTSPSRPPRKGSLTRNITFESDMTAALDEMQRSTSVLDMNGMGEELDDKKKRGRSPFKF
FSKKSRDQSREKMGGRNLDTSLERRNTVAHGRNVVNQQMTTRTPTLRLNNADIPPSPVAQ
GPKQLSSSNLGQPPVESSGNEMFDAECLKMINEYFYGVRIFPGQDPTHVYVGWVTTQYHL
HSRDFNKNKVRRGSVYIEDDYEVPIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFV
GCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLS
AAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNSALQVHALKLSDIRGWSMLCEDPVSM
LALHIPEEDRCIDILELIEMDKLLSFHAHTLTLYAALCYQSNYRAAHALCQHVDQKQLLY
AIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGVELKELYSDDEMKHSLR
SLVTESVRPQLRMTEITPPVIATSSMPSVSSEPIPNIDQLYSPKFPLEVVREFVMEALKD
AVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQKLLVMVDPETWDATFEK
EGKDEHTKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRR
YIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLEADDQDNCTCGLELRSRLGDFH
DSLMQKVSLNALQEPDGTESTAIEEIKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPE
EVFRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINNRARDD
VAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVM
MNTLGRRAQAQSDAPATQAEGALGGEGGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQK
AMFDHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRC
GLQSNSELVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLG
PALRGEGEGLFRAIVEANRMSERISDRCKMQDEAEGTIAGLNFTHPLPESEEDEDYIDTG
AAILNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLNQT
APGEEKPKSDMPSGLLPNNKQSIVLFLERVYGIEQQDLFYRLLEDAFLPDLRTATILDKS
DGSESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQ
REAVSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQ
GQGSYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKN
TDEDYYGRQMGAPDQPQYVPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGSWTY
GEVRSDAERKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVDVPLNHRGS
TRRQSKPQIHDFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEEL
NGCGGVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGVVEGEGGVTQ
AAVELRFSYSLLEKLIQYLDRATINMKLLKPSTTFSRRTSFKTASRDIKFFSKVVLPLME
KYFSTHRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCL
QVLVKGIDAKTLTKNCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTS
LGYVNQVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDATLTHDRKYL
KTEIERHRPALGSCLGAYSSCFPVAYLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESC
MPNLETILSEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTM
VTADHMNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVK
KRTENMLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHW
LKDNIPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEG
VPAVGGKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRY
LKKMTEYDVIEFARMQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANANSNE
KGKDKTQETVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHS
LPRHRACNIFARSYYEQWLQEENVGQEVMVEDLTQTFEESEKSKKDEEETDGKPDPLTQL
VTTFCRGAMTERSGALQEDLLYMSYAQIAAKSCGEEEEEGGDEEGGEGGGGEEGEGTSIH
EQEMEKQKLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQM
GMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEF
TCALFRFIQLTSEGHNLEWQNYLRTQAGNTTTVNVVISTVDYLLRLQESIMDFYWHYSSK
EIIDPAGKANFFKAIGVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQ
DKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILK
YFDMFLKLADLIESPSFHEIDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHE
GKIDYRAFVERFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGR
IEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCED
AIFEMTHASGLMASDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVH
MLSPSNIKHQIGVMQTKSIPELIVGFFKIIFYMFYYTGYAHFCVVRYIFGILLNLMRGPA
PEQEEEPVVEEETFGRALPPLPLEEPPGTVQAFGLDINKEENGMYKVVVHESPANSSMEE
GGESSPEDGTAPGGAEGLEGGEPHQEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASI
EAEAKKSSAAPQETPAVHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKV
TSFAEESEGSAEEELILGSGSGAGVDLGGGSGGGGLGSGDGGSGDGEDMDDDIPELVHVD
EDFFYMEHVLRMAAMLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFDGLFIAEQPE
DDDFKSHWDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKTAFAAQES
EETGIFRYIMNVDWRYQLWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVG
FKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVVAFNFFRKFYIQEEDEEVDKKCHDML
TCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAF
GELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPD
TEYTGQETYVWNMYQQRSWDFFPVGDCFRKQYEDELSGGGGGG
Download sequence
Identical sequences 7260.FBpp0249821 FBpp0249821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]