SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0251162 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0251162
Domain Number 1 Region: 1123-1328
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-43
Family Fibronectin type III 0.0002
Further Details:      
 
Domain Number 2 Region: 1328-1525
Classification Level Classification E-value
Superfamily Fibronectin type III 4.95e-37
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 1617-1794
Classification Level Classification E-value
Superfamily Fibronectin type III 3.02e-29
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 637-738
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 1025-1129
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 1536-1619
Classification Level Classification E-value
Superfamily Immunoglobulin 5.22e-20
Family I set domains 0.049
Further Details:      
 
Domain Number 7 Region: 927-1029
Classification Level Classification E-value
Superfamily Immunoglobulin 3.17e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 738-830
Classification Level Classification E-value
Superfamily Immunoglobulin 9.38e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 9 Region: 545-630
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 10 Region: 469-551
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000397
Family I set domains 0.042
Further Details:      
 
Domain Number 11 Region: 823-929
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000155
Family I set domains 0.045
Further Details:      
 
Domain Number 12 Region: 41-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000194
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0251162
Domain Number - Region: 305-391
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00186
Family I set domains 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0251162   Gene: FBgn0224004   Transcript: FBtr0252670
Sequence length 2234
Comment type=protein; loc=scf2_1100000004513:join(6268742..6268808,6280815..6281162,6282727..6282888,6283102..6283263,6283601..6283762,6285451..6285621,6287804..6287953,6296000..6296119,6299143..6299266,6299909..6300753,6300809..6300970,6301086..6301391,6315366..6315485,6315546..6316772,6316839..6316994,6317048..6317840,6317907..6318083,6318146..6318312,6321531..6321698,6324237..6324392,6325982..6326140,6326493..6326806,6326871..6327051,6327106..6327264,6328970..6329036,6330482..6330563); ID=FBpp0251162; name=DwilGK22019-PA; parent=FBgn0224004,FBtr0252670; dbxref=FlyBase:FBpp0251162,FlyBase_Annotation_IDs:GK22019-PA,GB_protein:EDW74618,REFSEQ:XP_002063632,FlyMine:FBpp0251162; MD5=b23e8b6b72e3f142041f329f1760d0a9; length=2234; release=r1.3; species=Dwil;
Sequence
MAHNMPNERLKWLMLFAAVAVFATAISTTNAANPPDADQKGPVFLKEPTNRIDFSNSTGA
EIECKSSGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYAC
LARNQFGSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHT
DQDENYFPGTEYVVSQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHTDQDESF
YPDAEYVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDFLPGSEY
VVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQIEAWVDDEGVELWCNNSTGAYDGK
YLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPISSSPPKINAL
TYKPNIVDYHMATAIFVQLRVIPLPVLEPVGAKAPTFSGESKSFTFVKEISSSFALLCQA
QAYPVPILRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGE
SVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLR
IESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCV
AGGNPTPEISWELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSK
VGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLMVTCPVAGYPIDSIVWERDNRALPINRK
QKVFPNGTLIIENVERNSDQATYTCVAKNQEGYSARGSLEVQVMVPPQIVPFAFGEETIN
MNDMVSATCTVNKGDTPIELYWTTAPDPKIGVGRLMSNDGILITKTTQRISMLSIESVHA
RHRANYTCVARNLAGVVYHTTELRVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQV
TWKKAVGDTPGEYKDLKKSDNIRVEEGTLHIDNIQKTNEGYYLCEAINGIGSGLSAVIMV
SVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEI
LSAGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRS
VQLSWAQPYDGNSPLNRYIIEFKRSRASWSEIDRVMVPGHTTEAQVQKLSPATTYNIRIV
AENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQTTMRVTWKPPPRSEWNGEILGYY
VGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLCDEEK
QFTAEGTPSQPPSDTACTTLTSQTIRVSWVSPPLESANGVIKTYKVVYASSDEWYDETKR
HYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQTEPDVPEAPTDVKALVM
GNAAILVSWRAPAQPNGIITQYTVYSKAEGAETETKTQKVPHYQMSFEATELEKNKPYEF
WVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCLAVGAPQPEITW
KIKGVEFTANDRMRLLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITHKLIVLAPPQSP
HVTLSATTTDTLTVKLKPHEGDTAPLHGYTLHYKPEFGEWETAEVSVESQKQNIEGLLCG
SRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVSSNSVSLHFKAWKDGGCP
MSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEPATWYNLRITAHNSAGFTVAEYDFA
TLTVTGGTIAPSRDLPELSAEDTIRIILSNLNLVVPVVAALLVIIIAIIVICILRSKGNH
HKDDVVYNQTMGPGATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGGL
RSNHSTWDPRRPNLYEELKAPPVPMHGNHYGHAHAHAGNVECHYRHPGMEDEICPYATFH
LLGFREEMDPTKAMNFQTFPHQNGHAGPVGPGHAGTMLPPGHPGHVHSRSGSQSMPRANR
YQRKNSQGGQSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCA
PEEDQYGSQYGGPYGQPYDHYGSRGSMGRRSIGSARNPGTGSPEPPPPPPRNHDMSNSSF
NDSKESNEISEAECDRDHGPRGNYGAVKRSPQPKDQRTTEEMRKLIERNEAGTKQLQLQQ
TNGAGFTAYDTMAV
Download sequence
Identical sequences B4MR79
FBpp0251162 7260.FBpp0251162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]