SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0252314 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0252314
Domain Number 1 Region: 1380-1480
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000236
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0252314   Gene: FBgn0225133   Transcript: FBtr0253822
Sequence length 1493
Comment type=protein; loc=scf2_1100000004954:join(2462876..2462884,2462950..2463378,2463460..2464135,2464194..2465185,2467848..2468540,2468598..2468831,2469038..2469853,2469921..2470553); ID=FBpp0252314; name=DwilGK23171-PA; parent=FBgn0225133,FBtr0253822; dbxref=FlyBase:FBpp0252314,FlyBase_Annotation_IDs:GK23171-PA,GB_protein:EDW85603,REFSEQ:XP_002074617,FlyMine:FBpp0252314; MD5=2b0a4cb4917a520daa83741e61f858a0; length=1493; release=r1.3; species=Dwil;
Sequence
MTTTFIGSKYHAEEEDEEEDDEDEDEEEDSCSSTSFSLQECINEFRARRIRRVSTHSRDC
ENVHTPGPMVVPDPQIAASADADLINQNRCNKAQERKGKPCKNGFCYCFTSDSGDCGSII
VPTRTRDSHVRHQKRSRRLESHHNQKLSTQLPKDRSKKGENQQGCRSNPAALAPLTAVSR
LCTTDENAPLIHIIQELRDNCVVSEVRVNRHKLSETSRRSKSQPVMTPKVGIIQPRIYEP
TAPPLSNISEQNDSAPIEEDHHLIEEVGTSLKSGRSRRSSSGGGGRLLQKRLSSQGEVSF
KTRDALKPPPKPPRRVTQSLDGKFSLSSLTSTCASVREAEQVLDEFLKSRGIQLPKSSSP
TKKTKRKSYPMSATEKPKCKPNAVVPSCPSLSDMERIVKSKRGVHYAKNIQQALSRKEPV
EKNIIIGWAEPKIEQMLNHQSKVHQSQAEPQVAIGWQLPSQPQIQQIEPRAVMPKVSLDT
VDGGVCENLDRGKKHTPIKYPTKGEQASQKFIWGEQWRNLSPWNGSKKGKSLGKKSKNFL
NQSKQKILRFVSPKKTNHQQEDHSQTLPRHCSVGVQTSMQSRSNLELNLQSLSPPGSYHS
PVQSTPSASSGRQQNVTDLEPERPYFDFERQVPAPRISPKKLSRCNRARKLDFKSTEQPT
RTYRSYQKELDQDVTITKIGYLLSSIREKLEASDDRAVQTFQDCTRFNPLKRHENVTFDC
LDGPHRSVISTSDEGALQTHQHVEQLHNSEPIYSEIEEDCLRIRGSPQYEVRTAAFLPEI
TPVSTPCVGVSTLAVNERKATTVPVPPPIDPDVIYAKVKKPCKMQVKTQPVALGKFLHES
LKNGSFFQFSPLPMEPSSSFDVLTEATESRRTPSTVHQSLNNISEQHSPPKKNRSLSKSE
LSLQRSEIFLDNLCRSEIVLDREESTRLEKVPNNCLRQIDKSTSADVVSYDLPHESGAGL
YEEFEMVDASAGGTSFATTTVYGSCQIEPLSPPSENQSTPKKKPDSRFTTKPTRSLSVDI
NDGPSTPVRPFGLNLSQSCPTSPHQPPSASLDEFIDTLPSRTESQLLSVSAMARYRLLKD
AVRRSYRRGKSLILAKTHSLNQSHDQSNQTEGELDGSTTYASFQLDSLLNNSLSTNEQLA
AAVSICRQMPDLEISAEMVEAERLLLFSTLRQKSLTDATRSQIQSQDGRKAQCFLIDGMQ
LPVRADASQDMFFNYYFISTFECEGRICSTQSVECQSGMAVFRDCGLEFYSSDQADTLEL
RCQIFMLRLRKVSTLALEPTKTMKQRDSTSLSSSSSCSTSREQIVSRFRLHASFSLRPSQ
LAPFDLVASETKSSDEMCLRSFRSWSLPLTSHTKSTNLEPYITLTGRVEVRLPKVQYAAY
LNVQDSKTKHHWNRHWCTLEGVQLSVWRQENNLSDEPPLINLQLDTNRRSTVDPVPRELC
ARARTFMLNCRISNGESMEVFFAADTQAELTDWLKHLNETLAFSKKWLSGGEA
Download sequence
Identical sequences B4NML4
FBpp0252314 XP_002074617.1.14588 7260.FBpp0252314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]