SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0252421 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0252421
Domain Number 1 Region: 410-535
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-28
Family Ran-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0252421   Gene: FBgn0225240   Transcript: FBtr0253929
Sequence length 536
Comment type=protein; loc=scf2_1100000004954:join(4201315..4201519,4201574..4202637,4202710..4203051); ID=FBpp0252421; name=DwilGK23278-PA; parent=FBgn0225240,FBtr0253929; dbxref=FlyBase:FBpp0252421,FlyBase_Annotation_IDs:GK23278-PA,GB_protein:EDW85837,REFSEQ:XP_002074851,FlyMine:FBpp0252421; MD5=ff9c448f00858234c2afa8c87ab4bacb; length=536; release=r1.3; species=Dwil;
Sequence
MSAKRQATSNLNHENWDQEEEPEQRGTFKTATQEELNLRVIKKARRKVAGAGKDETASET
KNVFSGFSGFGKPAASTSSPYAFLSKLPASTSEVGTTSSQSTFSFLGGGDSAKPKNEAAP
AGTFSFGAKKEATSTSSSSTPSSIFGKIGNEPAKSIATPAASTSMFKASVPSENAPVVAK
SSSSNSQPSSEYRENVADLNRGIIKFIKDNIDENPYCILTPVFDNYNKHLEELKDEEAAK
SGKTTSTSSSAETAPSFSFGKPSNPIGGSTQPLLFGKKPNCTITSGTSTTPAPKPLFSFG
QSTTSSTSTTTSTTTSIFSLSSSTPATSASADATKPGFFSLGRKDDATSPPKTNGFSFGL
KTDGDEKPSTSGFSGFGKPAAASEGAPATGFFSFGKPAETAQPTAAATENEEEDTPPKVE
FKQVVEDDAVYSKRCKVYVKNKDKDFADRGVGTLFLKPVKDSEKTQLLVRADTNLGNILV
NLILSKGLPAERMGKNNVMMVCVPTPEESKATTMLLRVKTADDADELLDQIKQHIK
Download sequence
Identical sequences B4NN98
7260.FBpp0252421 XP_002074851.1.14588 FBpp0252421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]