SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0253371 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0253371
Domain Number 1 Region: 592-786
Classification Level Classification E-value
Superfamily Sec7 domain 4.45e-71
Family Sec7 domain 0.00000212
Further Details:      
 
Domain Number 2 Region: 90-161,357-558,818-872,1021-1408
Classification Level Classification E-value
Superfamily ARM repeat 1.32e-22
Family Armadillo repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0253371   Gene: FBgn0226190   Transcript: FBtr0254879
Sequence length 1672
Comment type=protein; loc=scf2_1100000004585:complement(7152073..7152210,7152273..7156348,7156527..7157331); ID=FBpp0253371; name=DwilGK24228-PA; parent=FBgn0226190,FBtr0254879; dbxref=FlyBase:FBpp0253371,FlyBase_Annotation_IDs:GK24228-PA,GB_protein:EDW78041,REFSEQ:XP_002067055,FlyMine:FBpp0253371; MD5=e1a2a70d2a740fcd169837f9b346329b; length=1672; release=r1.3; species=Dwil;
Sequence
MQSSSTKTKEMFIVRALEKILADKDIRRSHHSQLKKSCDSALEQIKAELISAGQIAEGNE
LPCAALPLPKNDAGSIINAETYFLPFELACKSRSPRIVVTALDCLQKLIAYGHLTGSIQD
SSNPGHLLIDRIVITIYGCFNGPQTDEGVQLQIIKALLTVVTSQHVEIHEFTLLQAVRTC
YDIYLSSKNLVNQTTARATLTQMLNVIFARMENQVYELPPTTPTPVTSSLNGSINSAEES
NGEDASKEALAGDSDEVIASELLAEIITAAYNEAFKDESGQENGGTDVEANPSSLPAVNG
HDSSSHSDHDSVELHSESDAVVTAKFTHILQKDAFLVFRALCKLSMKPLPDGHPDPKSHE
LRSKVLSLHLLLLILQNAGPVFRSNEMFIMAIKQYLCVALSNNGVSLVPEVFELSLSIFV
ALLSNFKVHLKRQIEVFFKEIFLNILEASSSSFEHKWMVIQALTRICADAQSVVDIYVNY
DCDFSAANLFERLVNDLSKIAQGRQALELGANPLQEKSMRIRGLECLVSILKCMVEWSKD
LYVNPNMPAPLQVVSPTDDQVDTIPATAMTVYSGSSHSLNSYQEQLQDLPEALEERKMRK
EVMETGIVLFNKKPQKGVQFLQEKQLLGGTPQDIAKWLHEDERLDKTVIGNYLGENDDHS
KEVMCAYIDAFNFRQLEVVAALRILLEEFRLPGEAQKIDRLMEKFASRYCECNPQNPIFQ
SADTVYVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEIA
EHEIKMKNNSAVLVAKPTGKQPFITEKRRKLLWNMEMEAISSTATNLMQSVSHVKSPFTS
AKHLEHVRPMFKMAWTPFLAAFSVGLQDCDDPEIATLCLDGIRCAIRIACIFHMSLERDA
YVQALARFTLLNANSPINEMKAKNIDTIKTLIMVAHTDGNYLGPSWLDIVKCISQLELAQ
LIGTGVRPQFLSGAQTTLKDSLNPSVKEHIGETSSQSVVVAVDRIFTGSMRLDGDAIVDF
VKALCQVSVDELQQPQPRMFSLQKIVEISYYNMERIRLQWSRIWQVLGEHFNTVGCNSNE
EISFFALDSLRQLSMKFMEKGEFSNFRFQKDFLRPFEHIMKKNASPAIRDMVVRCIAQMV
NSQAHNIRSGWKNIFSIFHLAAGDHEEPIVELAFQTTGKIIGDLYQRQFAIMVDSFQDAV
KCLSEFATARFPDTSMEAIRLVRTCAQCVNEAPHLFAEHAGMENDASVAEEDRVWVRGWF
PMLFSLSCVVNRCKLDVRTRALTVLFEIVKTYGDSFKPNWWKDLFNVIFRIFDNMKLPEH
VTEKSEWMTTTCNHALYAIIDVFTQYFDVLGHLLLEELFAQLLWCVQQNNEQLARSGTNC
LENLVISNGFKFNEVTWDKTCQCILDIFNATLPQDLLNWRPKVAAHSNGPTQQQEHNLFE
ALHIRCVVQLELIQTMDNIVFFPATSRKEDAETLAQAAADLTGSRGGSQSQLLDCQREEQ
GMYGYLRTRQLLNLADCLMQSHRFAKHFNCDHDQRSLLWRAGFKGSVKPNLLKQETASLA
CVLRIFFKMYGDENRRSDWPGIEQELVQVCQEALAYYLSLQSEAHRDAWTSILLLILTRL
LKMSDARFATHVSNYYGLLCDMMCFDLKPELRSVLRRVFMRIGPVFNILSVK
Download sequence
Identical sequences B4N160
7260.FBpp0253371 FBpp0253371 XP_002067055.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]