SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0254001 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0254001
Domain Number 1 Region: 65-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-43
Family SPRY domain 0.00056
Further Details:      
 
Domain Number 2 Region: 243-278
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000785
Family SOCS box-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0254001   Gene: FBgn0226817   Transcript: FBtr0255509
Sequence length 301
Comment type=protein; loc=scf2_1100000004585:join(8372721..8373365,8373437..8373655,8373761..8373802); ID=FBpp0254001; name=DwilGK24858-PA; parent=FBgn0226817,FBtr0255509; dbxref=FlyBase:FBpp0254001,FlyBase_Annotation_IDs:GK24858-PA,GB_protein:EDW78173,REFSEQ:XP_002067187,FlyMine:FBpp0254001; MD5=b893ceef6442a13fc9350c5e47c4eee5; length=301; release=r1.3; species=Dwil;
Sequence
MSDIEQQKQQPSVVFTPRRRRHVGGRRGCPTSTQEEHKPSTSSSSTSSSLSSSPLSHAPS
IVCPMSLGIEDNWTWSKRYRSKEVVINGPTVHFHPNWSKGTAGVQGKRPLNYGRHYWELH
VSQRVFGTSIMFGIGTRSARLHVNAFRNMLGENEHGWGLSHKGVLWHKGVALRYTKRFRE
NHPTQIGILFDGVEGTLTYYKDGRCLGVAFRGLDQVKEPLYPIVCSTAAKTEMTLKSTRR
EFVNLQDRCRAVIMRRIRNLDQLDKLKLPLPISDYLSEVIDDMEPLRQVSDLEMYILNYD
L
Download sequence
Identical sequences 7260.FBpp0254001 FBpp0254001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]