SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000011 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000011
Domain Number 1 Region: 249-337
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.16e-16
Family Hypothetical protein YjcS 0.067
Further Details:      
 
Domain Number 2 Region: 30-97
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000892
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000011   Gene: ENSGGOG00000000011   Transcript: ENSGGOT00000000011
Sequence length 352
Comment pep:known_by_projection chromosome:gorGor3.1:8:89592677:89758496:1 gene:ENSGGOG00000000011 transcript:ENSGGOT00000000011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVL
SGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKD
YQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPG
KRSSRRVQRHNSFSPNSPQFNVSGPGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEE
EIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYM
IYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNNN
Download sequence
Identical sequences H2QWF0
ENSGGOP00000000011 ENSGGOP00000000011 XP_004047337.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]