SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000023 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000023
Domain Number 1 Region: 62-328
Classification Level Classification E-value
Superfamily PP2C-like 6.54e-76
Family PP2C-like 0.000000418
Further Details:      
 
Domain Number 2 Region: 332-400
Classification Level Classification E-value
Superfamily Protein serine/threonine phosphatase 2C, C-terminal domain 1.83e-19
Family Protein serine/threonine phosphatase 2C, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000023   Gene: ENSGGOG00000000024   Transcript: ENSGGOT00000000024
Sequence length 430
Comment pep:known_by_projection chromosome:gorGor3.1:19:42716861:42720720:1 gene:ENSGGOG00000000024 transcript:ENSGGOT00000000024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLARQLQRLLWTACKKKEREKEGREEEEEEEAGRRAPEGPRSLLTAPRRAQRPHGGAE
ASGGLRFGASAAQGWRARMEDAHCTWLSLPGLPPGWALFAVLDGHGGARAARFGARHLPG
HVLQELGPEPSEPEGVREALRRAFLSADERLRSLWPRVETGGCTAVVLLVSPRFLYLAHC
GDSRAVLSRAGAVAFSTEDHRPLRPRERERIHAAGGTIRRRRVEGSLAVSRALGDFAYKE
APGRPPELQLVSAEPEVAALARQAEDEFMLLASDGVWDTVSGAALAGLVASRLRLGLAPE
LLCAQLLDTCLCKGSLDNMTCILVCFPGAPRPSEEKIRRELALDAALCRRIAELCASAQK
PPSLNTVFRTLASEDIPDLPPGGGLDCKATVIAEVYSQICQVSEECREKGQDGDGKSTPT
HLGSALDMEA
Download sequence
Identical sequences G3QCS8
ENSGGOP00000000023 XP_004061013.1.27298 ENSGGOP00000000023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]