SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000043 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000043
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-27
Family SH2 domain 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000043   Gene: ENSGGOG00000000044   Transcript: ENSGGOT00000000044
Sequence length 351
Comment pep:known_by_projection chromosome:gorGor3.1:19:16459778:16469369:1 gene:ENSGGOG00000000044 transcript:ENSGGOT00000000044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEAGKLPLPLPPRLDWFVHTQMGQLAQDGVPEWFHGAISREDAENLLESQPLGSFLIRV
SHSHVGYTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLEALVTFHQQKPIEPRREL
LTQPCRQKDPANADYEDLFLYSNAVAEEAACPVSATEEASPKPVLCHQSKERKPSAEMNR
ITTKEATSSCPAKAPLGETRQKLWRSLKMLPERGQRVRQQLKHLATVNLSSLLDVRRSTV
ISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCIE
VTPGDMSWHQMVVRALSSQESKPEHQGLADPENDQLPEEYQQPPPFAPGYC
Download sequence
Identical sequences ENSGGOP00000000043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]