SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000046 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000046
Domain Number 1 Region: 86-299
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.76e-82
Family Fibrinogen C-terminal domain-like 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000046   Gene: ENSGGOG00000000047   Transcript: ENSGGOT00000000047
Sequence length 299
Comment pep:known_by_projection chromosome:gorGor3.1:1:28338468:28344196:-1 gene:ENSGGOG00000000047 transcript:ENSGGOT00000000047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPG
PQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVF
CDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELR
VELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDS
SNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Download sequence
Identical sequences G3QCU8 O75636
ENSP00000270879 gi|27754776|ref|NP_003656.2| ENSGGOP00000000046 ENSGGOP00000000046 9606.ENSP00000270879 NP_003656.2.87134 NP_003656.2.92137 XP_004025312.1.27298 ENSP00000270879 ENSP00000270879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]