SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000048 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000048
Domain Number 1 Region: 663-796
Classification Level Classification E-value
Superfamily HIT-like 0.0000000068
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000048   Gene: ENSGGOG00000000049   Transcript: ENSGGOT00000000049
Sequence length 894
Comment pep:known_by_projection chromosome:gorGor3.1:11:104980875:105111152:-1 gene:ENSGGOG00000000049 transcript:ENSGGOT00000000049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSMAADRGRFESAKSIEERKEQTRNARAEVLRQAKANFEKEERRKELKRLRGEDTWML
PDVNERIEQFSQEHSVKKKKKKDKHSKKAKKEKKKKSKKQKYEKNNESSDSSSSSEDEWV
EAVPSQTPDKEKAWKVKDEKSEKDDTQIIKRDEWMTVDFMSVKTVSSSSLKAEKETMRKI
EQEKTQALEQSKLMERELNPYWKDGGTGLPPEDCSVSSITKVSVVEDGGLSWLRKSYLRM
KEQAEKQSRNFEDIVAERYGSMEIFQSKLEDAEKAASTKEDYRRERWRKPTYSDKAQNCQ
ESRESDLVKYGNSSRDRYTTTDTAKNSNNEKFIGDEKDKRPGSLETCRRESNPRQNQEFS
FGNLRAKFLRPSDDEELSFHSKGRKFEPPSSSSALVAQGSLCSGFRKPTKNSEERLTSWS
RSDGRGDKKPSNQKPLETGTDEYQHVPEDPREKSQDEVLRDDPPKKEHLRDTKSTFAGSP
EHESIHILSVDEKNKLGAKIIKAEMMGNMELAEQLKVQLEKANKFKETITQIPKKSGVEN
EDQQEVILVRTDQSGRVWPVNTPGKSLESQGGRGKRQMVSTHEEKERVRYFHDDDNLSLN
DLVKNEKMGTAENQNKLFMRMASKFMGKTDGDYYTLDDMFVSKAAERERLGEEEESQRKK
AVAEHRSLAAQMEKCLYCFDSSQFPKHLIVAVGVKVYLCLPNVRSLTEGHCLIVPLQHHR
AATLLDEDIWEEIQMFRKSLVNMFEDKGLDCIFLETNMSMKKQYHMVYECIPLPKEVGDM
APIYFKKAIMESDEEWSMNKKLIDLSSKDIRKSVPRGLPYFSVDFGLHGGFAHVIEDQHK
FSHYFGKEIIGGMLDIEPRLWRKGIRESFEDQRKKALQFAQWWKPYDFTKSKNC
Download sequence
Identical sequences G3QCV0
ENSGGOP00000000048 ENSGGOP00000000048 XP_004052119.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]