SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000072 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000072
Domain Number 1 Region: 100-124
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000301
Family CCCH zinc finger 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000072
Domain Number - Region: 127-176
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0785
Family BRCA2 tower domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000072   Gene: ENSGGOG00000000073   Transcript: ENSGGOT00000000073
Sequence length 426
Comment pep:known_by_projection chromosome:gorGor3.1:2b:74648076:74672835:1 gene:ENSGGOG00000000073 transcript:ENSGGOT00000000073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKQAQAGGSKKAEQKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQVKFGQQNPRQV
AQSEAEKKLKKDDKKKELQELNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTKGDKCK
FSHDLTLERKCEKRSVYIDARDEELEKDTMDNWDEKKLEEVVNKKHGEAEKKKPKTQIVC
KHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERER
SALGPNVTKITLESFLAWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPE
LVNDDDEEADDTRYTQGTGGDEVDDSGSVNDIDLSLYIPRDVDETGITVASLERFSTYTS
DKDENKLSEASGGRAENGERSDLEEDNEREGPENGAIDAVPVDENLFTGEDLDELEEELN
TLDLEE
Download sequence
Identical sequences G3QCX0
ENSGGOP00000000072 ENSGGOP00000000072 XP_004032977.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]