SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000079 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000079
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily DTD-like 3.92e-55
Family DTD-like 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000079   Gene: ENSGGOG00000000080   Transcript: ENSGGOT00000000080
Sequence length 209
Comment pep:known_by_projection chromosome:gorGor3.1:20:19024159:19213226:1 gene:ENSGGOG00000000080 transcript:ENSGGOT00000000080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESG
KHWSKSVMDKQYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYSPE
LIKDGKFGAYMQVHIQNDGPVTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSE
SSKERNTPRKEDRSASSGAEGDVSSEREP
Download sequence
Identical sequences G3QCX7 H2QK09
ENSPTRP00000022793 XP_003316892.1.37143 XP_004061912.1.27298 XP_004061914.1.27298 XP_016793007.1.37143 9598.ENSPTRP00000022793 ENSGGOP00000000079 ENSGGOP00000000079 ENSPTRP00000022793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]