SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000089 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000089
Domain Number 1 Region: 189-390,617-813
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-80
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00031
Further Details:      
 
Domain Number 2 Region: 36-147
Classification Level Classification E-value
Superfamily RING/U-box 5.53e-19
Family Zf-UBP 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000089   Gene: ENSGGOG00000000091   Transcript: ENSGGOT00000000091
Sequence length 814
Comment pep:known_by_projection chromosome:gorGor3.1:6:99224804:99297960:-1 gene:ENSGGOG00000000091 transcript:ENSGGOT00000000091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVKDPTKALPGKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWS
VCSECLKERRFYDGQLVLTSDIWLCLKCGFQGCGKNSESQHSLKHFKSSRTEPHCIIINL
STWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQK
GGKCRSLSVRGITNLGNTCFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLDP
LVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKAPRFKDFQQQDSQELLHY
LLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFIDRIFIGELTS
TVMCEECANISTVKDPFIDISLPIIEERVSKPLLWGRMNKYRSLRETDHDRYSGNVTIEN
IHQPRAAKKHSSSKDKSQLIHDRKCIRKLSSGETVTYQKNENLEMNGDSLMFASLMNSES
RLNESPTDDSEKEASHSESNVDADSEPSESESASKQTGLFRSSSGSGVHPDGPLYPLSAG
ELLYTKETDSGDKEMAEAISELRLSSTVTGDQDFDRENQPLNISNNLCFLEGKHLRSHSP
QNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCENCTKNKQKYQEETSFAEK
KVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKVNRHVDFPLMLDLAPFCSATCK
NASVGDKVLYGLYGIVEHSGSMREGHYTAYVKVRTPSRKLSEHNAKKKNVPGLKAADSES
AGQWVHVSDTYVQVVPESRALSAQAYLLFYERVL
Download sequence
Identical sequences G3RMD4
ENSGGOP00000000089 XP_004044492.1.27298 XP_018884773.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]