SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000119 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000119
Domain Number 1 Region: 234-292
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.81e-17
Family Erythroid transcription factor GATA-1 0.00057
Further Details:      
 
Domain Number 2 Region: 183-231
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000157
Family Erythroid transcription factor GATA-1 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000119   Gene: ENSGGOG00000000120   Transcript: ENSGGOT00000000121
Sequence length 395
Comment pep:known_by_projection chromosome:gorGor3.1:20:60772689:60783824:-1 gene:ENSGGOG00000000120 transcript:ENSGGOT00000000121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGAARXATPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAARP
GWAQTATADSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGALLP
REQFAAPLGRPVGTSYSASYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEF
PGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRAGLC
CTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKARG
SSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEF
KFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA
Download sequence
Identical sequences ENSGGOP00000000119 ENSGGOP00000000119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]