SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000130 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000130
Domain Number 1 Region: 2-38,146-239,637-890
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.83e-92
Family Calcium ATPase, transmembrane domain M 0.00087
Further Details:      
 
Domain Number 2 Region: 254-467
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.56e-66
Family Metal cation-transporting ATPase, ATP-binding domain N 0.000000107
Further Details:      
 
Domain Number 3 Region: 233-257,393-515,562-631
Classification Level Classification E-value
Superfamily HAD-like 1.87e-40
Family Meta-cation ATPase, catalytic domain P 0.0000853
Further Details:      
 
Domain Number 4 Region: 37-144
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.02e-28
Family Calcium ATPase, transduction domain A 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000130   Gene: ENSGGOG00000000130   Transcript: ENSGGOT00000000132
Sequence length 900
Comment pep:known_by_projection chromosome:gorGor3.1:19:32843285:32854239:-1 gene:ENSGGOG00000000130 transcript:ENSGGOT00000000132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGD
LVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMC
LEGTAQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFIV
AMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAKRLASKNCVVKNLEAVETLGS
TSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQTFDQSSETWRALCRVLTLCN
RAAFKSGQDAVPVPKRIVIGDASETALLKFAELTLGNAMGYRDRFPKVCEIPFNSTNKFQ
QLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGL
GERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLVSMIDPPRATVPDAVLKCRT
AGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLRVPVDQVNRKDARACVINGM
QLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKA
DIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELT
PYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAESDIMHLRPRNPKRDRLVNEP
LAAYSYFQIGGCPWAGEPGAGFTDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ
EWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNKILVIAIVFQVC
IGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLGVRCCPGSWWDQELYY
Download sequence
Identical sequences ENSGGOP00000000130 ENSGGOP00000000130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]