SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000151 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000151
Domain Number 1 Region: 365-453,503-633,807-882,941-979
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.47e-43
Family WD40-repeat 0.002
Further Details:      
 
Domain Number 2 Region: 165-480
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-24
Family Quinoprotein alcohol dehydrogenase-like 0.042
Further Details:      
 
Domain Number 3 Region: 43-126
Classification Level Classification E-value
Superfamily EF-hand 0.000000000368
Family Polcalcin 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000151
Domain Number - Region: 605-674
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0934
Family WD40-repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000151   Gene: ENSGGOG00000000152   Transcript: ENSGGOT00000000153
Sequence length 1286
Comment pep:novel chromosome:gorGor3.1:20:30193847:30291134:1 gene:ENSGGOG00000000152 transcript:ENSGGOT00000000153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEDLAEIPQLQKLSIPHGFQNKEAASPTPSITLSLVPDLQPGSQLFTEVHLAKIEKMF
EEDINSTGALGMDAFIKAMKKVLSSVSDEMLKELFLKVDSDCEGFVTWQKYVDYMMREFQ
GKEDMRKSQYRLHFYLPMMVVPLNHGCEVVKVVFLIHRFKKIGCFLTVTKDGILQFWSES
FSLMSSFRLNQTQQLYSQPMWVIDMVCLHNMNLVAVASTRQKIDFFDISDHKCVRAFTFV
DLDSCALVMDYWSDYHRGVFCYGDAKGNVIVFTSENMTSGLFNPRILPRASKWDHWIKVS
LQKLLNEKSALHRSYRLKALHPNWCEQVKFIPQMNVVVSCSAIEKSSLVLTILPAKASEK
PRLSVLHLRKGILCFDYCPDRNFLVTGGYDAFIRLWNPFVSKRPVWLMKGHQTSVTHILV
DSRNNSILISVSKDKNIRVWDMLDYICLQSFCGKFFALGNCPITSAYFFEKDNTLICSTY
SIGILKGYLEAQGPIKARKRTTHCSPLCAVLYSKIFKQVVSGCLRGTVSVWEVVTGRKTM
EFAVSGGQHVEMTAMALDESERCLLTGLRDGTMKMWNYNIGKCLLTFPSPEQLEISGIIH
MNKVFYVTGWSKRITHFLFHKTKLVLLCYHWQTYHTEDILSMAKYQNQFLGTSSYSGDIL
FWNTSTLKPIFNFNASRSPLPLQPKRVQDVNNCLAESHRPSRPCVEWEKWAYKTSRKLSS
LSPESVANTNLRQSLVSAPPVMRCPRDKEPDRPVPQQKPSSASGTSRQSSKIHSKQSIYK
EDETRNGELRKNMLVQSNASVEKIIFLQTRPRLPHTAALLSSCMDGYIYAWSLHGNGGLL
GKFPVDLDNGDVVVGAMATDINDWIFITGDCKGYIKIWDIKDYCTLIDKQPFQSSGAKVV
SEAHNKFRLLIPQQLGTSFPHYIPLEDKEVVAGHTISLVPPTLLITWKGHLNSVADILYV
DNFQLVISAGQDRDVKAWKLSGDAIGTFGLSVWKRLQDARDGPHENRASLEEDGDSTGTT
QKALHLELQEQRDLAEALIYQRREQAALMALLHGKADKEADAWAKLQKMALMSPWARERP
LEDIEDSWNKWESRDKQVSKVLGVAYKLKERLQNTRFLSTRVPYAWMKHQISPQVYQSLH
FSDLTPTQQPDFLTSRGPDQQDQHICLVAHHVQKDLVPSRKQAVLDTMDSTPVAASSPSS
LLSVTASASRLLDSSLPAFLMPQFSLLRPQSASTAHSTPSVPSPVSKSTLQRSVTPKHIV
SSFEQPPRPLKATFMSSVKGGSHVRF
Download sequence
Identical sequences ENSGGOP00000000151 ENSGGOP00000000151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]