SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000179 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000179
Domain Number 1 Region: 20-111
Classification Level Classification E-value
Superfamily L domain-like 4.76e-21
Family mRNA export factor tap 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000179   Gene: ENSGGOG00000011889   Transcript: ENSGGOT00000000184
Sequence length 214
Comment pep:known_by_projection chromosome:gorGor3.1:1:129081314:129098130:-1 gene:ENSGGOG00000011889 transcript:ENSGGOT00000000184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMKKKINLELRNRSPEEPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKD
LSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEED
DEDGDEDDEEEEENEAGPPEGYEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKE
EIQEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD
Download sequence
Identical sequences ENSGGOP00000000179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]