SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000216 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000216
Domain Number 1 Region: 213-278
Classification Level Classification E-value
Superfamily RING/U-box 1.9e-20
Family RING finger domain, C3HC4 0.0044
Further Details:      
 
Domain Number 2 Region: 77-118
Classification Level Classification E-value
Superfamily PA domain 0.0000628
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000216   Gene: ENSGGOG00000000219   Transcript: ENSGGOT00000000221
Sequence length 351
Comment pep:known_by_projection chromosome:gorGor3.1:17:5048700:5053542:1 gene:ENSGGOG00000000219 transcript:ENSGGOT00000000221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPAAFPLPVVVAAVLWGAAPTRGLIRATSDHNASMDFADLPALFGATLSQEGLQGFLVE
AHPDNACSPIAPPPPAPVNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELL
NMVWNSEEIQQQIWIPSVFIGERSSEYLRALFVYEKGARVLLVPDNTFPLGYYLIPFTGI
VGLLVLAMGAVMIARCIQHRKRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDG
DKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEDQEEETQGQEEGDEEGEP
RDHPASERTPLLGSSPTLPTSFGSLAPAPLVFPGPSTDPPPSPPSSPVILV
Download sequence
Identical sequences G3QDA6
ENSGGOP00000000216 ENSGGOP00000000216 XP_004058407.1.27298 XP_008960789.1.60992 XP_008960790.1.60992 XP_008960791.1.60992 XP_008960792.1.60992 XP_008960793.1.60992 XP_018868645.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]