SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000232 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000232
Domain Number 1 Region: 11-156
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-29
Family C-type lectin domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000232
Domain Number - Region: 255-341
Classification Level Classification E-value
Superfamily PKD domain 0.000249
Family PKD domain 0.012
Further Details:      
 
Domain Number - Region: 816-876
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 0.00513
Family gamma-adaptin C-terminal appendage domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000232   Gene: ENSGGOG00000000233   Transcript: ENSGGOT00000000237
Sequence length 972
Comment pep:novel chromosome:gorGor3.1:16:71654551:71707382:-1 gene:ENSGGOG00000000233 transcript:ENSGGOT00000000237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVGLVLLVLALRLRATTAKPEEGSFCSKSQVAFRDACYEFVPLGRTFRDAQSWCEGQG
GHLVFIQDEGTQRFLQKHISQDREWWIGLTWNLARNGTTEGPGTWLDTSNVTYSNWHGGQ
AAAAPDTCGHIGRGPSSEWVASDCAQTFAFVCEFRVGQSLAYKGLNATMHCGSGQVIQVQ
DAVYGRQNPHFCTQDAGRPSDLEQGCSWANVKEEMAGQCQGLQPCQVAADGTYFGNLCPT
QGSYLWVQYQCREALQLMVSSESFIFDNVTISLTWLLSPYIGNLSCIISTGDSHTFDPYK
LLSVSSNVTHQFTSPGEFTVFAECTTSEWHVTAQRQVTVRDKMERLSVTACSGLSQSGAG
PLCQAVFGDPLWIQMELDGGTGVTYTVLLGDITLAESITQKGSLPYNLTLDRETQKLMGP
VRHRLEIQATSTTTTSTISRNITVHLVEPLSGLQASWASDHLELGQDLLINISLAQGTPE
ELSFEVAGLNATFSHEQVSFGEPFGIYRLAVPVEGTFLVTMLVRNAFSNLSLEIGNITIT
KDKGDMEVYIQPGPYVDPFTTVTLDWPDNDKELRFQWSCGPCWAQSGCVERQLLRTDQRE
LVVPASCLPPPDSAVTLRLAVLRGQELENRAEQCLYVSTPWELRPRVSCERNCRPVNASK
DILLRVTMGEDSPVAMFSWYLDNTPTEQAEPLPDACRLRGFWPRSLTLLQSNTSTLLLNS
SFLQSRGEVIRIRATALTRHAYGEDTYVISTLPSPEVPACTIAPEEGTVLTSFAIFCNAS
AALGPLEFCFCLESGSSLHCGPETALPSVYLPLGKENNDFVLTVVISATNRAGDTQQTQA
VAKVALGDTCVEDVAFQAALSEKIPTALQGEGGPEQLLQLAKAVSSVLNQEHESQGSGQS
LSMDVRKVREHVLGSLSAVTTGLEDVQRVQELAEVLREVTCRSKELTPSAQGSCIGDSWE
GAPPAAHVSHAG
Download sequence
Identical sequences ENSGGOP00000000232 ENSGGOP00000000232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]